BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0372 (574 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.041 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 31 0.67 SB_6393| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-28) 27 8.2 SB_46486| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.7) 27 8.2 >SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 36.7 bits (81), Expect = 0.013 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -1 Query: 253 PSGFPLTST*PGIVHHLSGPSICA 182 P FPL S GIVHHLSGP+ CA Sbjct: 6 PPEFPLASPYSGIVHHLSGPNRCA 29 >SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 35.1 bits (77), Expect = 0.041 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = -3 Query: 254 SIRVSPDFDLTRHSSPSFGSQHLCS 180 S RVS F L RHSSPSFGSQ + S Sbjct: 40 STRVSSGFTLFRHSSPSFGSQQMRS 64 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 32.7 bits (71), Expect = 0.22 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 317 ISLSPLYPVPTIDLHVR 267 ISLSPLYP TIDLHVR Sbjct: 38 ISLSPLYPNLTIDLHVR 54 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 31.1 bits (67), Expect = 0.67 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = -3 Query: 542 SAYQNWPTWHRLRSSASSFE*AGVLTHLKFENR 444 S YQN PT R+ + + G+LT+LKFENR Sbjct: 86 SGYQNGPTRTRIHCPGFNKQ-VGLLTNLKFENR 117 >SB_6393| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-28) Length = 307 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 214 VHHLSGPSICAQSAPSFTDWKRDASGVRKSR 122 V L+ S+C Q APSF + K+ AS VR ++ Sbjct: 183 VRKLAKISLCDQYAPSFKEKKKMASEVRVAK 213 >SB_46486| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.7) Length = 703 Score = 27.5 bits (58), Expect = 8.2 Identities = 15/60 (25%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = +1 Query: 175 RSEHKCWDPKD--GELCLVRSKSGETLMETVAILTCKSIVGTGYRGERLIEPSSSWFRPK 348 +++ C D ++ GE +KS +T ++ +C+S++ TG + L + S RP+ Sbjct: 303 QNDLSCSDSENEGGESFSTTAKSKDTKANDYSMTSCRSVLATGLNEQSLAKRKESIRRPE 362 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,449,949 Number of Sequences: 59808 Number of extensions: 356808 Number of successful extensions: 902 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 810 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 902 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1361520496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -