BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0372 (574 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024877-7|AAF60907.3| 438|Caenorhabditis elegans Hypothetical ... 27 9.5 AC006624-7|AAF39787.1| 642|Caenorhabditis elegans Hypothetical ... 27 9.5 >AC024877-7|AAF60907.3| 438|Caenorhabditis elegans Hypothetical protein Y95B8A.11 protein. Length = 438 Score = 27.1 bits (57), Expect = 9.5 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +1 Query: 379 NFKTVSSGKAND*RHWGRNDLNLFSNFKWVRTP--AYSNDE 495 NF + S K+N + + +LFS+F+W RTP A SN+E Sbjct: 38 NFSNLESPKSNSSSLF---EDSLFSSFRWKRTPERAPSNNE 75 >AC006624-7|AAF39787.1| 642|Caenorhabditis elegans Hypothetical protein C53D5.5 protein. Length = 642 Score = 27.1 bits (57), Expect = 9.5 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 8/78 (10%) Frame = +1 Query: 166 MKARSEHKCWDPKDGELCLVRSKSGETLMETVA-----ILTCKSIVGTGYRGERL---IE 321 M ++S ++ K EL V G T++ VA L K+ V R+ ++ Sbjct: 521 MSSQSPLVIFNTKGAELMAVGGAGGSTIISGVAGVALHALWLKADVKQAVDAPRMHNQLQ 580 Query: 322 PSSSWFRPKFPSG*LASI 375 P+ +W+ P FP + S+ Sbjct: 581 PNYTWYEPNFPKAYVKSL 598 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,909,525 Number of Sequences: 27780 Number of extensions: 269261 Number of successful extensions: 522 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 515 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 522 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1184216096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -