BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0369 (696 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 25 0.45 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 25 0.45 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 21 9.6 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 25.4 bits (53), Expect = 0.45 Identities = 11/34 (32%), Positives = 23/34 (67%) Frame = +1 Query: 343 SRLVQGSYQFVYGKSISNVRKSEIFKALNLKQKK 444 ++LV+ +F +GK +S R+ +I + LNL +++ Sbjct: 98 AQLVELEREFHHGKYLSRPRRIQIAENLNLSERQ 131 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 25.4 bits (53), Expect = 0.45 Identities = 11/34 (32%), Positives = 23/34 (67%) Frame = +1 Query: 343 SRLVQGSYQFVYGKSISNVRKSEIFKALNLKQKK 444 ++LV+ +F +GK +S R+ +I + LNL +++ Sbjct: 89 AQLVELEREFHHGKYLSRPRRIQIAENLNLSERQ 122 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 679 RTNRHLVGENRHDGHSTLS 623 R RHL+ H H+T S Sbjct: 268 RFTRHLIQRRTHTRHTTTS 286 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,325 Number of Sequences: 336 Number of extensions: 3149 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -