BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0367 (743 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4G8.08 |||iron ion transporter |Schizosaccharomyces pombe|ch... 30 0.30 SPAC1093.04c |||tRNA nucleotidyltransferase |Schizosaccharomyces... 29 0.53 SPCC622.19 |jmj4|mug149|Jmj4 protein|Schizosaccharomyces pombe|c... 27 2.1 SPAC17C9.10 |stm1||G-protein coupled receptor Stm1|Schizosacchar... 27 2.8 SPAC17H9.10c |ddb1||damaged DNA binding protein Ddb1 |Schizosacc... 27 3.7 SPBC1105.10 |rav1||RAVE complex subunit Rav1 |Schizosaccharomyce... 26 6.5 SPBC3B8.04c |||membrane transporter|Schizosaccharomyces pombe|ch... 25 8.6 >SPAC4G8.08 |||iron ion transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 271 Score = 30.3 bits (65), Expect = 0.30 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 498 YLPTLISHWNESVCEESIKLLVNRFLYYECSIIVPFC 608 YLPT +S W VC E K + + ++ S+I P C Sbjct: 146 YLPTTVSWW---VCYEESKKYLQKQSNWDISVIAPIC 179 >SPAC1093.04c |||tRNA nucleotidyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 500 Score = 29.5 bits (63), Expect = 0.53 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -2 Query: 658 LRLIKCIKFTKKFNFNLQNGTI 593 LR ++CI+F K++FN+ TI Sbjct: 191 LRAVRCIRFATKYDFNIHEETI 212 >SPCC622.19 |jmj4|mug149|Jmj4 protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 473 Score = 27.5 bits (58), Expect = 2.1 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -2 Query: 226 LIP*IMSNIVHTRKYVWIGKSHFGKKNNVSH 134 + P +M N+V + +WIGKS G + + H Sbjct: 150 ITPALMGNLVPQQCNLWIGKSENGTSSGLHH 180 >SPAC17C9.10 |stm1||G-protein coupled receptor Stm1|Schizosaccharomyces pombe|chr 1|||Manual Length = 271 Score = 27.1 bits (57), Expect = 2.8 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -1 Query: 299 ARLQVLVSFRPKKSTTGFIILFYTTHSINNVKY 201 AR+ ++ KST G I+F+ S+ N Y Sbjct: 192 ARIPQIIKNHKAKSTEGLSIIFFVLASVGNTSY 224 >SPAC17H9.10c |ddb1||damaged DNA binding protein Ddb1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1072 Score = 26.6 bits (56), Expect = 3.7 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -2 Query: 616 FNLQNGTIILHS*YKNRFTKSLIDSSHTDS 527 FN QNG +I HS +N+ + I H DS Sbjct: 597 FNFQNGQVIEHSLRRNQLGVAPIILKHFDS 626 >SPBC1105.10 |rav1||RAVE complex subunit Rav1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1297 Score = 25.8 bits (54), Expect = 6.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 43 NFIYVIHGCRYRYNVESVHEH 105 +F Y++H CR R++ S H H Sbjct: 182 DFSYLVHPCRVRFSQWSKHLH 202 >SPBC3B8.04c |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 867 Score = 25.4 bits (53), Expect = 8.6 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +3 Query: 231 VKKNDKACSAFFRSKAYKHLKPGR-FLTRVGTSKT*NRIS*ISACYIAKICI*LQYFISY 407 +KK DK + R K + FL G KT ++ I A + AK+C F++ Sbjct: 277 LKKYDKTLGSSLRESYMKRVNQAYPFLPATG--KTLSKRLNIVAEWYAKLCCQGDTFVAI 334 Query: 408 KQLRGDFK 431 ++LRG + Sbjct: 335 RRLRGHLR 342 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,808,359 Number of Sequences: 5004 Number of extensions: 56157 Number of successful extensions: 127 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 353266144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -