BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0367 (743 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14102| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0024) 30 1.7 SB_32204| Best HMM Match : wnt (HMM E-Value=8.2e-31) 29 5.3 >SB_14102| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0024) Length = 515 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +3 Query: 435 CSIARKKNICLVSKRISQTLTY----LPTLISHWNESVCEE 545 C + RK C V K++ + L +P +IS+W+ + C E Sbjct: 128 CPVRRKYRRCRVGKKVKERLNSKVYKIPVVISNWSRNGCHE 168 >SB_32204| Best HMM Match : wnt (HMM E-Value=8.2e-31) Length = 731 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Frame = +3 Query: 435 CSIARKKNICLVSKRISQTLTY----LPTLISHWNESVCEE 545 C + RK C K++ + L +P +IS+W+ + C E Sbjct: 112 CPVRRKYRRCRAGKKVKERLNSKVYKIPVVISNWSRNGCHE 152 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,525,579 Number of Sequences: 59808 Number of extensions: 367868 Number of successful extensions: 684 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 684 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2010148439 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -