BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0367 (743 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY330179-1|AAQ16285.1| 171|Anopheles gambiae odorant-binding pr... 26 1.1 AY146737-1|AAO12097.1| 119|Anopheles gambiae odorant-binding pr... 23 7.5 >AY330179-1|AAQ16285.1| 171|Anopheles gambiae odorant-binding protein AgamOBP53 protein. Length = 171 Score = 26.2 bits (55), Expect = 1.1 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 3/40 (7%) Frame = +2 Query: 359 LLYCKD---LYLITIFYKLQTVKG*FQVM*YCQKEKYMPR 469 LLYC + L++ I+Y+ + F+V CQ E+ +PR Sbjct: 2 LLYCNEFHFLFMYNIYYRALWLFLKFEVPHCCQMEELIPR 41 >AY146737-1|AAO12097.1| 119|Anopheles gambiae odorant-binding protein AgamOBP27 protein. Length = 119 Score = 23.4 bits (48), Expect = 7.5 Identities = 12/39 (30%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +1 Query: 22 VDYNIILNFIYVIHGCRYRYNVE-SVHEHSRLEQTLVSN 135 +D +L + ++H CR + +E SV E R V N Sbjct: 4 LDLVCLLAIVLLVHSCRNEFEIEPSVFESLRAGNFSVRN 42 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 692,317 Number of Sequences: 2352 Number of extensions: 13765 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -