BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0366 (725 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0EIA0 Cluster: Chromosome undetermined scaffold_98, wh... 34 3.1 UniRef50_A0RTS7 Cluster: Ribosomal protein S3AE; n=2; Thermoprot... 34 4.1 >UniRef50_A0EIA0 Cluster: Chromosome undetermined scaffold_98, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_98, whole genome shotgun sequence - Paramecium tetraurelia Length = 664 Score = 34.3 bits (75), Expect = 3.1 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Frame = -2 Query: 406 LSLKQMVQIR*IIVSGPQFALFTSDLKSEKNLSELL-FILVHLYFQRYLLYLILDH 242 LS QM Q++ +S P+F + T + + +LS+LL F+L LYF ++L +I H Sbjct: 456 LSFNQMKQLQSSALSAPEFNI-TGLIHPQLHLSQLLTFLLQGLYFHGWMLQIITIH 510 >UniRef50_A0RTS7 Cluster: Ribosomal protein S3AE; n=2; Thermoprotei|Rep: Ribosomal protein S3AE - Cenarchaeum symbiosum Length = 203 Score = 33.9 bits (74), Expect = 4.1 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 1/75 (1%) Frame = -1 Query: 377 IDNCQRSAIRIIYIRFEIRKKFIRTFIHTGSS-IFSTISVVSHLGS*YPIKHIFIINQHL 201 ID + I+ R+E K+++R+ + GSS + + V + G + +K + + +HL Sbjct: 70 IDKVSEESATSIFKRYEYSKEYLRSLVRRGSSKVNYIVDVKTSDGYVFRLKVLALTYRHL 129 Query: 200 NRSILY*ISLSIRTI 156 N S + + L IR + Sbjct: 130 NTSKKHALRLIIRDV 144 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 584,309,851 Number of Sequences: 1657284 Number of extensions: 9785818 Number of successful extensions: 17767 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17225 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17759 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 59090914597 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -