BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0366 (725 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT024336-1|ABC86398.1| 271|Drosophila melanogaster IP10110p pro... 29 8.5 AE014134-1566|AAO41172.1| 257|Drosophila melanogaster CG32987-P... 29 8.5 >BT024336-1|ABC86398.1| 271|Drosophila melanogaster IP10110p protein. Length = 271 Score = 28.7 bits (61), Expect = 8.5 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +2 Query: 2 LYLNVFH*TEYVINTVFISSNVLFYLSICKHCVPFIRF 115 L L H Y+ ++ + ++F + IC HC+P I + Sbjct: 59 LMLTHIHLQRYLPFPCYVLALIIFLVMICMHCIPRISY 96 >AE014134-1566|AAO41172.1| 257|Drosophila melanogaster CG32987-PA protein. Length = 257 Score = 28.7 bits (61), Expect = 8.5 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +2 Query: 2 LYLNVFH*TEYVINTVFISSNVLFYLSICKHCVPFIRF 115 L L H Y+ ++ + ++F + IC HC+P I + Sbjct: 45 LMLTHIHLQRYLPFPCYVLALIIFLVMICMHCIPRISY 82 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,878,441 Number of Sequences: 53049 Number of extensions: 443673 Number of successful extensions: 630 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 630 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3252477558 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -