BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0365 (515 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 88 5e-18 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) 88 5e-18 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 88 5e-18 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 88 5e-18 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 88 5e-18 SB_21148| Best HMM Match : PAN (HMM E-Value=0.49) 88 5e-18 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 88 5e-18 SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_5755| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 87 8e-18 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 1e-16 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 8e-10 SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2) 60 8e-10 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 58 4e-09 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 58 6e-09 SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) 58 6e-09 SB_857| Best HMM Match : Mago_nashi (HMM E-Value=0) 58 6e-09 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 7e-09 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 7e-09 SB_2599| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 7e-09 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 57 1e-08 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) 57 1e-08 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) 56 1e-08 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 1e-08 SB_20517| Best HMM Match : Nuclease_act (HMM E-Value=1.4) 56 1e-08 SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) 56 1e-08 SB_7317| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 1e-08 SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) 56 2e-08 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 56 2e-08 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 56 2e-08 SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) 56 2e-08 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 56 2e-08 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 56 2e-08 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 56 2e-08 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 56 2e-08 SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) 56 2e-08 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 56 2e-08 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 56 2e-08 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) 56 2e-08 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 56 2e-08 SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 56 2e-08 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 56 2e-08 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 56 2e-08 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 56 2e-08 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) 56 2e-08 SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 56 2e-08 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 56 2e-08 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 56 2e-08 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 56 2e-08 SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) 56 2e-08 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 56 2e-08 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 56 2e-08 SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 56 2e-08 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 56 2e-08 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 56 2e-08 SB_52605| Best HMM Match : UPF0004 (HMM E-Value=3.6) 56 2e-08 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_51037| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 56 2e-08 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_47765| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08) 56 2e-08 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 56 2e-08 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 56 2e-08 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_42773| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_42727| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 56 2e-08 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 56 2e-08 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_38298| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_37805| Best HMM Match : DoxA (HMM E-Value=1.7) 56 2e-08 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 56 2e-08 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 56 2e-08 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 56 2e-08 SB_34031| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 56 2e-08 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 56 2e-08 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 56 2e-08 SB_27070| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 56 2e-08 SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) 56 2e-08 SB_18568| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.5e-22) 56 2e-08 SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) 56 2e-08 SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) 56 2e-08 SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) 56 2e-08 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 56 2e-08 SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_11965| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_11390| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_11195| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_10723| Best HMM Match : Chromo (HMM E-Value=0.031) 56 2e-08 SB_10325| Best HMM Match : ubiquitin (HMM E-Value=3.4e-05) 56 2e-08 SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_9135| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_8821| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_8316| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_8089| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_6860| Best HMM Match : zf-C3HC4 (HMM E-Value=0.14) 56 2e-08 SB_6458| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) 56 2e-08 SB_5051| Best HMM Match : DUF1193 (HMM E-Value=0.88) 56 2e-08 SB_4934| Best HMM Match : NAD_binding_2 (HMM E-Value=4.8) 56 2e-08 SB_4559| Best HMM Match : ICAM_N (HMM E-Value=5.3) 56 2e-08 SB_3948| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_3585| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_3444| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_3301| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_742| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 56 2e-08 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 56 2e-08 SB_6296| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 3e-08 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 3e-08 SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_13637| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 5e-08 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 54 5e-08 SB_37138| Best HMM Match : RnaseA (HMM E-Value=8) 54 5e-08 SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) 54 5e-08 SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) 54 7e-08 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_32717| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 54 7e-08 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 54 9e-08 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 54 9e-08 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 54 9e-08 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 53 1e-07 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 53 1e-07 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 53 1e-07 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 53 1e-07 SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) 53 1e-07 SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) 53 1e-07 SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) 53 1e-07 SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) 53 1e-07 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 53 1e-07 SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) 53 1e-07 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 53 1e-07 SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) 53 1e-07 SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) 53 1e-07 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 53 1e-07 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 53 1e-07 SB_10448| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_10073| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 53 1e-07 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 53 1e-07 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 53 1e-07 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 53 1e-07 SB_56846| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_55386| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 53 1e-07 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 53 1e-07 SB_44687| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 53 1e-07 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 53 1e-07 SB_29112| Best HMM Match : Mucin (HMM E-Value=1.7) 53 1e-07 SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) 53 1e-07 SB_26142| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_18550| Best HMM Match : DUF987 (HMM E-Value=4.4) 53 1e-07 SB_17258| Best HMM Match : DUF791 (HMM E-Value=0.002) 53 1e-07 SB_16872| Best HMM Match : ARM_1 (HMM E-Value=0) 53 1e-07 SB_9530| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) 53 1e-07 SB_6524| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_5006| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_3953| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_3169| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_1434| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 53 2e-07 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) 53 2e-07 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 53 2e-07 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 53 2e-07 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 53 2e-07 SB_19170| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_16558| Best HMM Match : SoxE (HMM E-Value=8.2) 53 2e-07 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 53 2e-07 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_53938| Best HMM Match : Gln-synt_N (HMM E-Value=0.78) 53 2e-07 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_36434| Best HMM Match : Ins_allergen_rp (HMM E-Value=5.7) 53 2e-07 SB_33876| Best HMM Match : EGF (HMM E-Value=2.4e-08) 53 2e-07 SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_9823| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_6133| Best HMM Match : ABC_tran (HMM E-Value=9e-09) 53 2e-07 SB_870| Best HMM Match : 7tm_1 (HMM E-Value=5.3e-09) 53 2e-07 SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) 52 2e-07 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 52 3e-07 SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 52 3e-07 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_864| Best HMM Match : Sulfotransfer_1 (HMM E-Value=6.4e-05) 52 3e-07 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 52 4e-07 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 52 4e-07 SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) 52 4e-07 SB_43936| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 52 4e-07 SB_33112| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 52 4e-07 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 52 4e-07 SB_31147| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 52 4e-07 SB_27029| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_21178| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 52 4e-07 SB_10549| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_9649| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 52 4e-07 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_8298| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 52 4e-07 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 52 4e-07 SB_2218| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_57715| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_55419| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 52 4e-07 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_54385| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_51677| Best HMM Match : DUF327 (HMM E-Value=0.89) 52 4e-07 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_50879| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_50740| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_50212| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_49154| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_46319| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 52 4e-07 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_45133| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_44633| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_42693| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 52 4e-07 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_40779| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 52 4e-07 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_40094| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_39735| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_39698| Best HMM Match : Rho_RNA_bind (HMM E-Value=3.4) 52 4e-07 SB_39642| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_39320| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_39135| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 733 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) Length = 1652 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 400 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) Length = 846 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 818 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 573 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) Length = 996 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_21148| Best HMM Match : PAN (HMM E-Value=0.49) Length = 183 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1653 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) Length = 336 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_5755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 87.8 bits (208), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 338 MNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 M+ELTHINCVALTARFPVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 87.0 bits (206), Expect = 8e-18 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +1 Query: 382 LSSRETCRASCINESANARGXAVCVLGALPLPRSLTRCARSF 507 L+SRETCRASCINESANARG AVCVLGALPLPRSLTRCARSF Sbjct: 90 LNSRETCRASCINESANARGEAVCVLGALPLPRSLTRCARSF 131 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 83.4 bits (197), Expect = 1e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = +1 Query: 391 RETCRASCINESANARGXAVCVLGALPLPRSLTRCARSF 507 RETCRASCINESANARG AVCVLGALPLPRSLTRCARSF Sbjct: 457 RETCRASCINESANARGEAVCVLGALPLPRSLTRCARSF 495 >SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 60.5 bits (140), Expect = 8e-10 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 362 CVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 C++ T F VGKPVVPAALMNRPTRG +RFAYW Sbjct: 129 CISFTRIFRVGKPVVPAALMNRPTRGERRFAYW 161 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 197 ICDTGYIPLPRSLTRYARSF 216 >SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2) Length = 300 Score = 60.5 bits (140), Expect = 8e-10 Identities = 33/66 (50%), Positives = 39/66 (59%), Gaps = 3/66 (4%) Frame = +2 Query: 272 LSAHNSTQHTSRKHKV*SLGCLMNE---LTHINCVALTARFPVGKPVVPAALMNRPTRGX 442 +S + QH S KHK + GC E + + T VGKPVVPAALMNRPTRG Sbjct: 155 ISGEYAVQH-SCKHKAFTEGCKEPEGPKHRYFRRICCTTLLQVGKPVVPAALMNRPTRGE 213 Query: 443 KRFAYW 460 +RFAYW Sbjct: 214 RRFAYW 219 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 255 ICDTGYIPLPRSLTRYARSF 274 >SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 60.1 bits (139), Expect = 1e-09 Identities = 33/57 (57%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Frame = +2 Query: 293 QHTSRKHKV*S-LGCLMNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 +H +RK K+ S L M ++ I+ V L PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 102 EHKTRKTKLLSTLPPRMRKIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGERRFAYW 157 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 193 ICDTGYIPLPRSLTRYARSF 212 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 59.3 bits (137), Expect = 2e-09 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +2 Query: 326 LGCLMNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 L C+ +++ I+ V L PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 22 LNCVPSKIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGERRFAYW 65 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 101 ICDTGYIPLPRSLTRYARSF 120 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 59.3 bits (137), Expect = 2e-09 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +2 Query: 350 THINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 T +C+ ++ + VGKPVVPAALMNRPTRG +RFAYW Sbjct: 27 TGFHCILVSFGYSVGKPVVPAALMNRPTRGERRFAYW 63 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 58.0 bits (134), Expect = 4e-09 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +2 Query: 335 LMNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 +M + + VA AR VGKPVVPAALMNRPTRG +RFAYW Sbjct: 208 IMKKSGSVQIVAELAREYVGKPVVPAALMNRPTRGERRFAYW 249 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 285 ICDTGYIPLPRSLTRYARSF 304 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 57.6 bits (133), Expect = 6e-09 Identities = 34/65 (52%), Positives = 39/65 (60%) Frame = +2 Query: 266 KLLSAHNSTQHTSRKHKV*SLGCLMNELTHINCVALTARFPVGKPVVPAALMNRPTRGXK 445 K+L H T R+ G L E+ I+ V L PVGKPVVPAALMNRPTRG + Sbjct: 41 KVLGGHVLTYRLFRRDLA---GKLHIEIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGER 96 Query: 446 RFAYW 460 RFAYW Sbjct: 97 RFAYW 101 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 137 ICDTGYIPLPRSLTRYARSF 156 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 57.6 bits (133), Expect = 6e-09 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +2 Query: 368 ALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 A+ P+GKPVVPAALMNRPTRG +RFAYW Sbjct: 173 AINTTLPIGKPVVPAALMNRPTRGERRFAYW 203 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 239 ICDTGYIPLPRSLTRYARSF 258 >SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) Length = 753 Score = 57.6 bits (133), Expect = 6e-09 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = +2 Query: 380 RFPVGKPVVPAALMNRPTRGXKRFAYW 460 R P+GKPVVPAALMNRPTRG +RFAYW Sbjct: 212 RIPIGKPVVPAALMNRPTRGERRFAYW 238 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 274 ICDTGYIPLPRSLTRYARSF 293 >SB_857| Best HMM Match : Mago_nashi (HMM E-Value=0) Length = 900 Score = 57.6 bits (133), Expect = 6e-09 Identities = 25/44 (56%), Positives = 31/44 (70%) Frame = +2 Query: 329 GCLMNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 G L + + + +T + VGKPVVPAALMNRPTRG +RFAYW Sbjct: 826 GALPEVIESLPRIKITTQHTVGKPVVPAALMNRPTRGERRFAYW 869 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 57.2 bits (132), Expect = 7e-09 Identities = 31/62 (50%), Positives = 36/62 (58%), Gaps = 2/62 (3%) Frame = +2 Query: 281 HNSTQHTSRKHKV*SLGCLMNELTHINCVALT--ARFPVGKPVVPAALMNRPTRGXKRFA 454 +N T+H R V S+ T I + PVGKPVVPAALMNRPTRG +RFA Sbjct: 4 YNCTRHIERNAAVSSIDNAKKIDTSIKLIDTVDLEGGPVGKPVVPAALMNRPTRGERRFA 63 Query: 455 YW 460 YW Sbjct: 64 YW 65 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 101 ICDTGYIPLPRSLTRYARSF 120 >SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 57.2 bits (132), Expect = 7e-09 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = +2 Query: 329 GCLMNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 G N++ I+ V L PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 16 GHAKNDIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGERRFAYW 58 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 94 ICDTGYIPLPRSLTRYARSF 113 >SB_2599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 57.2 bits (132), Expect = 7e-09 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = +2 Query: 332 CLMNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 C+ + + I+ V L PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 19 CMKSVIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGERRFAYW 60 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 96 ICDTGYIPLPRSLTRYARSF 115 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 56.8 bits (131), Expect = 1e-08 Identities = 25/40 (62%), Positives = 30/40 (75%), Gaps = 5/40 (12%) Frame = +2 Query: 356 INCVALTARF-----PVGKPVVPAALMNRPTRGXKRFAYW 460 + C+A R+ P+GKPVVPAALMNRPTRG +RFAYW Sbjct: 58 VRCIAEGGRYKKNVSPIGKPVVPAALMNRPTRGERRFAYW 97 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 133 ICDTGYIPLPRSLTRYARSF 152 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 56.8 bits (131), Expect = 1e-08 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = +2 Query: 383 FPVGKPVVPAALMNRPTRGXKRFAYW 460 +P+GKPVVPAALMNRPTRG +RFAYW Sbjct: 71 YPIGKPVVPAALMNRPTRGERRFAYW 96 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 132 ICDTGYIPLPRSLTRYARSF 151 >SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) Length = 224 Score = 56.8 bits (131), Expect = 1e-08 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = +2 Query: 377 ARFPVGKPVVPAALMNRPTRGXKRFAYW 460 A F VGKPVVPAALMNRPTRG +RFAYW Sbjct: 106 AEFSVGKPVVPAALMNRPTRGERRFAYW 133 >SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 56.8 bits (131), Expect = 1e-08 Identities = 31/63 (49%), Positives = 37/63 (58%) Frame = +2 Query: 272 LSAHNSTQHTSRKHKV*SLGCLMNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRF 451 L+ N+T + K N + I+ V L PVGKPVVPAALMNRPTRG +RF Sbjct: 14 LAITNATPRATENLKKELCRIFNNNIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGERRF 72 Query: 452 AYW 460 AYW Sbjct: 73 AYW 75 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 111 ICDTGYIPLPRSLTRYARSF 130 >SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) Length = 1728 Score = 56.4 bits (130), Expect = 1e-08 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +2 Query: 341 NELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 N++ I+ V L PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 1659 NKIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGERRFAYW 1697 >SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 56.4 bits (130), Expect = 1e-08 Identities = 24/37 (64%), Positives = 27/37 (72%) Frame = +2 Query: 350 THINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 T + C R +GKPVVPAALMNRPTRG +RFAYW Sbjct: 90 TCLRCSRFHQRLKLGKPVVPAALMNRPTRGERRFAYW 126 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 162 ICDTGYIPLPRSLTRYARSF 181 >SB_20517| Best HMM Match : Nuclease_act (HMM E-Value=1.4) Length = 123 Score = 56.4 bits (130), Expect = 1e-08 Identities = 35/68 (51%), Positives = 43/68 (63%) Frame = +2 Query: 257 SCVKLLSAHNSTQHTSRKHKV*SLGCLMNELTHINCVALTARFPVGKPVVPAALMNRPTR 436 S VK+LS +N + KV G + + + I+ V L PVGKPVVPAALMNRPTR Sbjct: 33 SLVKMLSRNNVLE------KV-VFGSMKDYIKLIDTVDLEGG-PVGKPVVPAALMNRPTR 84 Query: 437 GXKRFAYW 460 G +RFAYW Sbjct: 85 GERRFAYW 92 >SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) Length = 145 Score = 56.4 bits (130), Expect = 1e-08 Identities = 29/54 (53%), Positives = 34/54 (62%) Frame = +2 Query: 299 TSRKHKV*SLGCLMNELTHINCVALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 TSR+ L L+ ++ T R VGKPVVPAALMNRPTRG +RFAYW Sbjct: 11 TSREFADMQLNPLVAHTILVHARTKTERTLVGKPVVPAALMNRPTRGERRFAYW 64 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 100 ICDTGYIPLPRSLTRYARSF 119 >SB_7317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 56.4 bits (130), Expect = 1e-08 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 Query: 259 LCEIVIRSQFHTTYEPEA*SVKPGVPNE 342 LCEIVIRS FHTTY+PEA SVKPGVPNE Sbjct: 62 LCEIVIRSVFHTTYDPEAESVKPGVPNE 89 >SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) Length = 168 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 113 PVGKPVVPAALMNRPTRGERRFAYW 137 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 112 PVGKPVVPAALMNRPTRGERRFAYW 136 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 172 ICDTGYIPLPRSLTRYARSF 191 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 37 PVGKPVVPAALMNRPTRGERRFAYW 61 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 97 ICDTGYIPLPRSLTRYARSF 116 >SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 134 PVGKPVVPAALMNRPTRGERRFAYW 158 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 236 PVGKPVVPAALMNRPTRGERRFAYW 260 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 296 ICDTGYIPLPRSLTRYARSF 315 >SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 56 PVGKPVVPAALMNRPTRGERRFAYW 80 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 61 PVGKPVVPAALMNRPTRGERRFAYW 85 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 121 ICDTGYIPLPRSLTRYARSF 140 >SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) Length = 187 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 132 PVGKPVVPAALMNRPTRGERRFAYW 156 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 86 PVGKPVVPAALMNRPTRGERRFAYW 110 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 146 ICDTGYIPLPRSLTRYARSF 165 >SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 50 PVGKPVVPAALMNRPTRGERRFAYW 74 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 146 PVGKPVVPAALMNRPTRGERRFAYW 170 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 43 PVGKPVVPAALMNRPTRGERRFAYW 67 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 103 ICDTGYIPLPRSLTRYARSF 122 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 33 PVGKPVVPAALMNRPTRGERRFAYW 57 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 93 ICDTGYIPLPRSLTRYARSF 112 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 333 PVGKPVVPAALMNRPTRGERRFAYW 357 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 393 ICDTGYIPLPRSLTRYARSF 412 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 88 PVGKPVVPAALMNRPTRGERRFAYW 112 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 148 ICDTGYIPLPRSLTRYARSF 167 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 74 PVGKPVVPAALMNRPTRGERRFAYW 98 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 134 ICDTGYIPLPRSLTRYARSF 153 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 307 PVGKPVVPAALMNRPTRGERRFAYW 331 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 367 ICDTGYIPLPRSLTRYARSF 386 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 108 PVGKPVVPAALMNRPTRGERRFAYW 132 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 168 ICDTGYIPLPRSLTRYARSF 187 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 34 PVGKPVVPAALMNRPTRGERRFAYW 58 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 94 ICDTGYIPLPRSLTRYARSF 113 >SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 468 PVGKPVVPAALMNRPTRGERRFAYW 492 >SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 28 PVGKPVVPAALMNRPTRGERRFAYW 52 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 93 PVGKPVVPAALMNRPTRGERRFAYW 117 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 153 ICDTGYIPLPRSLTRYARSF 172 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 53 PVGKPVVPAALMNRPTRGERRFAYW 77 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 113 ICDTGYIPLPRSLTRYARSF 132 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 154 PVGKPVVPAALMNRPTRGERRFAYW 178 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 53 PVGKPVVPAALMNRPTRGERRFAYW 77 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 113 ICDTGYIPLPRSLTRYARSF 132 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 37 PVGKPVVPAALMNRPTRGERRFAYW 61 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 97 ICDTGYIPLPRSLTRYARSF 116 >SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) Length = 216 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 161 PVGKPVVPAALMNRPTRGERRFAYW 185 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 57 PVGKPVVPAALMNRPTRGERRFAYW 81 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 117 ICDTGYIPLPRSLTRYARSF 136 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 79 PVGKPVVPAALMNRPTRGERRFAYW 103 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 139 ICDTGYIPLPRSLTRYARSF 158 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 56 PVGKPVVPAALMNRPTRGERRFAYW 80 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 116 ICDTGYIPLPRSLTRYARSF 135 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 17 PVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 56 PVGKPVVPAALMNRPTRGERRFAYW 80 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 39 PVGKPVVPAALMNRPTRGERRFAYW 63 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 99 ICDTGYIPLPRSLTRYARSF 118 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 290 PVGKPVVPAALMNRPTRGERRFAYW 314 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 350 ICDTGYIPLPRSLTRYARSF 369 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 37 PVGKPVVPAALMNRPTRGERRFAYW 61 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 97 ICDTGYIPLPRSLTRYARSF 116 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 78 PVGKPVVPAALMNRPTRGERRFAYW 102 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 138 ICDTGYIPLPRSLTRYARSF 157 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 24 PVGKPVVPAALMNRPTRGERRFAYW 48 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 84 ICDTGYIPLPRSLTRYARSF 103 >SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) Length = 189 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 134 PVGKPVVPAALMNRPTRGERRFAYW 158 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 92 PVGKPVVPAALMNRPTRGERRFAYW 116 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 152 ICDTGYIPLPRSLTRYARSF 171 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 33 PVGKPVVPAALMNRPTRGERRFAYW 57 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 93 ICDTGYIPLPRSLTRYARSF 112 >SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 36 PVGKPVVPAALMNRPTRGERRFAYW 60 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 232 PVGKPVVPAALMNRPTRGERRFAYW 256 >SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) Length = 190 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 135 PVGKPVVPAALMNRPTRGERRFAYW 159 >SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 28 PVGKPVVPAALMNRPTRGERRFAYW 52 >SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) Length = 911 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 744 PVGKPVVPAALMNRPTRGERRFAYW 768 >SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 92 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 37 PVGKPVVPAALMNRPTRGERRFAYW 61 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 134 PVGKPVVPAALMNRPTRGERRFAYW 158 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 194 ICDTGYIPLPRSLTRYARSF 213 >SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 95 PVGKPVVPAALMNRPTRGERRFAYW 119 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 219 PVGKPVVPAALMNRPTRGERRFAYW 243 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 279 ICDTGYIPLPRSLTRYARSF 298 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 45 PVGKPVVPAALMNRPTRGERRFAYW 69 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 105 ICDTGYIPLPRSLTRYARSF 124 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 53 PVGKPVVPAALMNRPTRGERRFAYW 77 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 113 ICDTGYIPLPRSLTRYARSF 132 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 95 PVGKPVVPAALMNRPTRGERRFAYW 119 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 155 ICDTGYIPLPRSLTRYARSF 174 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 63 PVGKPVVPAALMNRPTRGERRFAYW 87 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 123 ICDTGYIPLPRSLTRYARSF 142 >SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) Length = 409 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 107 PVGKPVVPAALMNRPTRGERRFAYW 131 >SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 93 PVGKPVVPAALMNRPTRGERRFAYW 117 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 32 PVGKPVVPAALMNRPTRGERRFAYW 56 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 92 ICDTGYIPLPRSLTRYARSF 111 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 41 PVGKPVVPAALMNRPTRGERRFAYW 65 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 101 ICDTGYIPLPRSLTRYARSF 120 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 935 PVGKPVVPAALMNRPTRGERRFAYW 959 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 995 ICDTGYIPLPRSLTRYARSF 1014 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 82 PVGKPVVPAALMNRPTRGERRFAYW 106 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 142 ICDTGYIPLPRSLTRYARSF 161 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 415 PVGKPVVPAALMNRPTRGERRFAYW 439 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 475 ICDTGYIPLPRSLTRYARSF 494 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 97 PVGKPVVPAALMNRPTRGERRFAYW 121 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 157 ICDTGYIPLPRSLTRYARSF 176 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 70 PVGKPVVPAALMNRPTRGERRFAYW 94 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 130 ICDTGYIPLPRSLTRYARSF 149 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 85 PVGKPVVPAALMNRPTRGERRFAYW 109 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 145 ICDTGYIPLPRSLTRYARSF 164 >SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) Length = 197 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 142 PVGKPVVPAALMNRPTRGERRFAYW 166 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 111 PVGKPVVPAALMNRPTRGERRFAYW 135 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 171 ICDTGYIPLPRSLTRYARSF 190 >SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 47 PVGKPVVPAALMNRPTRGERRFAYW 71 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 107 ICDTGYIPLPRSLTRYARSF 126 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 40 PVGKPVVPAALMNRPTRGERRFAYW 64 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 100 ICDTGYIPLPRSLTRYARSF 119 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 70 PVGKPVVPAALMNRPTRGERRFAYW 94 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 130 ICDTGYIPLPRSLTRYARSF 149 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 61 PVGKPVVPAALMNRPTRGERRFAYW 85 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 121 ICDTGYIPLPRSLTRYARSF 140 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 38 PVGKPVVPAALMNRPTRGERRFAYW 62 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 98 ICDTGYIPLPRSLTRYARSF 117 >SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 31 PVGKPVVPAALMNRPTRGERRFAYW 55 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 91 ICDTGYIPLPRSLTRYARSF 110 >SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) Length = 189 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 84 PVGKPVVPAALMNRPTRGERRFAYW 108 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 144 ICDTGYIPLPRSLTRYARSF 163 >SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 62 PVGKPVVPAALMNRPTRGERRFAYW 86 >SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 94 PVGKPVVPAALMNRPTRGERRFAYW 118 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 154 ICDTGYIPLPRSLTRYARSF 173 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 132 PVGKPVVPAALMNRPTRGERRFAYW 156 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C +PLPRSLTR ARSF Sbjct: 192 ICDTRYIPLPRSLTRYARSF 211 >SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 49 PVGKPVVPAALMNRPTRGERRFAYW 73 >SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) Length = 160 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 55 PVGKPVVPAALMNRPTRGERRFAYW 79 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 115 ICDTGYIPLPRSLTRYARSF 134 >SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 33 PVGKPVVPAALMNRPTRGERRFAYW 57 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 93 ICDTGYIPLPRSLTRYARSF 112 >SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 14 PVGKPVVPAALMNRPTRGERRFAYW 38 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 74 ICDTGYIPLPRSLTRYARSF 93 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 35 PVGKPVVPAALMNRPTRGERRFAYW 59 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 95 ICDTGYIPLPRSLTRYARSF 114 >SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 44 PVGKPVVPAALMNRPTRGERRFAYW 68 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 37 PVGKPVVPAALMNRPTRGERRFAYW 61 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 97 ICDTGYIPLPRSLTRYARSF 116 >SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) Length = 180 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 75 PVGKPVVPAALMNRPTRGERRFAYW 99 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 135 ICDTGYIPLPRSLTRYARSF 154 >SB_52605| Best HMM Match : UPF0004 (HMM E-Value=3.6) Length = 138 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 83 PVGKPVVPAALMNRPTRGERRFAYW 107 >SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1263 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 365 VALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 +++ +F VGKPVVPAALMNRPTRG +RFAYW Sbjct: 379 LSMKKKFLVGKPVVPAALMNRPTRGERRFAYW 410 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 446 ICDTGYIPLPRSLTRYARSF 465 >SB_51037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 27 PVGKPVVPAALMNRPTRGERRFAYW 51 >SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 127 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 37 PVGKPVVPAALMNRPTRGERRFAYW 61 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 97 ICDTGYIPLPRSLTRYARSF 116 >SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 48 PVGKPVVPAALMNRPTRGERRFAYW 72 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 108 ICDTGYIPLPRSLTRYARSF 127 >SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 92 PVGKPVVPAALMNRPTRGERRFAYW 116 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 152 ICDTGYIPLPRSLTRYARSF 171 >SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 126 PVGKPVVPAALMNRPTRGERRFAYW 150 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 186 ICDTGYIPLPRSLTRYARSF 205 >SB_47765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 19 PVGKPVVPAALMNRPTRGERRFAYW 43 >SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 32 PVGKPVVPAALMNRPTRGERRFAYW 56 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 92 ICDTGYIPLPRSLTRYARSF 111 >SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 18 PVGKPVVPAALMNRPTRGERRFAYW 42 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 78 ICDTGYIPLPRSLTRYARSF 97 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 71 PVGKPVVPAALMNRPTRGERRFAYW 95 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 131 ICDTGYIPLPRSLTRYARSF 150 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 99 PVGKPVVPAALMNRPTRGERRFAYW 123 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 159 ICDTGYIPLPRSLTRYARSF 178 >SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08) Length = 435 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 231 PVGKPVVPAALMNRPTRGERRFAYW 255 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 100 PVGKPVVPAALMNRPTRGERRFAYW 124 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 82 PVGKPVVPAALMNRPTRGERRFAYW 106 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 142 ICDTGYIPLPRSLTRYARSF 161 >SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) Length = 488 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 383 PVGKPVVPAALMNRPTRGERRFAYW 407 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 443 ICDTGYIPLPRSLTRYARSF 462 >SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 53 PVGKPVVPAALMNRPTRGERRFAYW 77 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 113 ICDTGYIPLPRSLTRYARSF 132 >SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) Length = 177 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 72 PVGKPVVPAALMNRPTRGERRFAYW 96 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 132 ICDTGYIPLPRSLTRYARSF 151 >SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 31 PVGKPVVPAALMNRPTRGERRFAYW 55 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 91 ICDTGYIPLPRSLTRYARSF 110 >SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 32 PVGKPVVPAALMNRPTRGERRFAYW 56 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 92 ICDTGYIPLPRSLTRYARSF 111 >SB_42773| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 100 PVGKPVVPAALMNRPTRGERRFAYW 124 >SB_42727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 82 PVGKPVVPAALMNRPTRGERRFAYW 106 >SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 86 PVGKPVVPAALMNRPTRGERRFAYW 110 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 146 ICDTGYIPLPRSLTRYARSF 165 >SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 17 PVGKPVVPAALMNRPTRGERRFAYW 41 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 77 ICDTGYIPLPRSLTRYARSF 96 >SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 28 PVGKPVVPAALMNRPTRGERRFAYW 52 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 88 ICDTGYIPLPRSLTRYARSF 107 >SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 77 PVGKPVVPAALMNRPTRGERRFAYW 101 >SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) Length = 558 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 453 PVGKPVVPAALMNRPTRGERRFAYW 477 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 513 ICDTGYIPLPRSLTRYARSF 532 >SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) Length = 178 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 73 PVGKPVVPAALMNRPTRGERRFAYW 97 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 133 ICDTGYIPLPRSLTRYARSF 152 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 90 PVGKPVVPAALMNRPTRGERRFAYW 114 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 150 ICDTGYIPLPRSLTRYARSF 169 >SB_38298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 23 PVGKPVVPAALMNRPTRGERRFAYW 47 >SB_37805| Best HMM Match : DoxA (HMM E-Value=1.7) Length = 788 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 733 PVGKPVVPAALMNRPTRGERRFAYW 757 >SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 18 PVGKPVVPAALMNRPTRGERRFAYW 42 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 78 ICDTGYIPLPRSLTRYARSF 97 >SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 32 PVGKPVVPAALMNRPTRGERRFAYW 56 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 92 ICDTGYIPLPRSLTRYARSF 111 >SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) Length = 178 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 73 PVGKPVVPAALMNRPTRGERRFAYW 97 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 133 ICDTGYIPLPRSLTRYARSF 152 >SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 34 PVGKPVVPAALMNRPTRGERRFAYW 58 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 94 ICDTGYIPLPRSLTRYARSF 113 >SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 44 PVGKPVVPAALMNRPTRGERRFAYW 68 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 104 ICDTGYIPLPRSLTRYARSF 123 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 100 PVGKPVVPAALMNRPTRGERRFAYW 124 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 160 ICDTGYIPLPRSLTRYARSF 179 >SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 201 PVGKPVVPAALMNRPTRGERRFAYW 225 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 261 ICDTGYIPLPRSLTRYARSF 280 >SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 106 PVGKPVVPAALMNRPTRGERRFAYW 130 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 166 ICDTGYIPLPRSLTRYARSF 185 >SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 142 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 37 PVGKPVVPAALMNRPTRGERRFAYW 61 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 97 ICDTGYIPLPRSLTRYARSF 116 >SB_34031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 23 PVGKPVVPAALMNRPTRGERRFAYW 47 >SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) Length = 286 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 181 PVGKPVVPAALMNRPTRGERRFAYW 205 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 241 ICDTGYIPLPRSLTRYARSF 260 >SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 66 PVGKPVVPAALMNRPTRGERRFAYW 90 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 126 ICDTGYIPLPRSLTRYARSF 145 >SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 36 PVGKPVVPAALMNRPTRGERRFAYW 60 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 96 ICDTGYIPLPRSLTRYARSF 115 >SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 18 PVGKPVVPAALMNRPTRGERRFAYW 42 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 78 ICDTGYIPLPRSLTRYARSF 97 >SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) Length = 473 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 20 PVGKPVVPAALMNRPTRGERRFAYW 44 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 80 ICDTGYIPLPRSLTRYARSF 99 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 292 PVGKPVVPAALMNRPTRGERRFAYW 316 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 352 ICDTGYIPLPRSLTRYARSF 371 >SB_27070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 19 PVGKPVVPAALMNRPTRGERRFAYW 43 >SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 110 PVGKPVVPAALMNRPTRGERRFAYW 134 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 170 ICDTGYIPLPRSLTRYARSF 189 >SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 51 PVGKPVVPAALMNRPTRGERRFAYW 75 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 111 ICDTGYIPLPRSLTRYARSF 130 >SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 182 PVGKPVVPAALMNRPTRGERRFAYW 206 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 242 ICDTGYIPLPRSLTRYARSF 261 >SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 37 PVGKPVVPAALMNRPTRGERRFAYW 61 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 97 ICDTGYIPLPRSLTRYARSF 116 >SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) Length = 370 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 265 PVGKPVVPAALMNRPTRGERRFAYW 289 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 325 ICDTGYIPLPRSLTRYARSF 344 >SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 28 PVGKPVVPAALMNRPTRGERRFAYW 52 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 88 ICDTGYIPLPRSLTRYARSF 107 >SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 48 PVGKPVVPAALMNRPTRGERRFAYW 72 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 108 ICDTGYIPLPRSLTRYARSF 127 >SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) Length = 568 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 463 PVGKPVVPAALMNRPTRGERRFAYW 487 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 523 ICDTGYIPLPRSLTRYARSF 542 >SB_18568| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.5e-22) Length = 636 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 60 PVGKPVVPAALMNRPTRGERRFAYW 84 >SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) Length = 370 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 265 PVGKPVVPAALMNRPTRGERRFAYW 289 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 325 ICDTGYIPLPRSLTRYARSF 344 >SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) Length = 136 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 31 PVGKPVVPAALMNRPTRGERRFAYW 55 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 91 ICDTGYIPLPRSLTRYARSF 110 >SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) Length = 213 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 108 PVGKPVVPAALMNRPTRGERRFAYW 132 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 168 ICDTGYIPLPRSLTRYARSF 187 >SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) Length = 171 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 66 PVGKPVVPAALMNRPTRGERRFAYW 90 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 126 ICDTGYIPLPRSLTRYARSF 145 >SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 90 PVGKPVVPAALMNRPTRGERRFAYW 114 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 150 ICDTGYIPLPRSLTRYARSF 169 >SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 70 PVGKPVVPAALMNRPTRGERRFAYW 94 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 130 ICDTGYIPLPRSLTRYARSF 149 >SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 107 PVGKPVVPAALMNRPTRGERRFAYW 131 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 167 ICDTGYIPLPRSLTRYARSF 186 >SB_11965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 19 PVGKPVVPAALMNRPTRGERRFAYW 43 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 79 ICDTGYIPLPRSLTRYARSF 98 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 335 PVGKPVVPAALMNRPTRGERRFAYW 359 >SB_11390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 22 PVGKPVVPAALMNRPTRGERRFAYW 46 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 82 ICDTGYIPLPRSLTRYARSF 101 >SB_11195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 596 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 541 PVGKPVVPAALMNRPTRGERRFAYW 565 >SB_10723| Best HMM Match : Chromo (HMM E-Value=0.031) Length = 191 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 86 PVGKPVVPAALMNRPTRGERRFAYW 110 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 146 ICDTGYIPLPRSLTRYARSF 165 >SB_10325| Best HMM Match : ubiquitin (HMM E-Value=3.4e-05) Length = 198 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 143 PVGKPVVPAALMNRPTRGERRFAYW 167 >SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 363 PVGKPVVPAALMNRPTRGERRFAYW 387 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 423 ICDTGYIPLPRSLTRYARSF 442 >SB_9135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 25 PVGKPVVPAALMNRPTRGERRFAYW 49 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 85 ICDTGYIPLPRSLTRYARSF 104 >SB_8821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 26 PVGKPVVPAALMNRPTRGERRFAYW 50 >SB_8316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 56.0 bits (129), Expect = 2e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 365 VALTARFPVGKPVVPAALMNRPTRGXKRFAYW 460 VAL VGKPVVPAALMNRPTRG +RFAYW Sbjct: 11 VALDGILAVGKPVVPAALMNRPTRGERRFAYW 42 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 78 ICDTGYIPLPRSLTRYARSF 97 >SB_8089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 20 PVGKPVVPAALMNRPTRGERRFAYW 44 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 80 ICDTGYIPLPRSLTRYARSF 99 >SB_6860| Best HMM Match : zf-C3HC4 (HMM E-Value=0.14) Length = 129 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 74 PVGKPVVPAALMNRPTRGERRFAYW 98 >SB_6458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 49 PVGKPVVPAALMNRPTRGERRFAYW 73 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 109 ICDTGYIPLPRSLTRYARSF 128 >SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) Length = 866 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 811 PVGKPVVPAALMNRPTRGERRFAYW 835 >SB_5051| Best HMM Match : DUF1193 (HMM E-Value=0.88) Length = 634 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 436 PVGKPVVPAALMNRPTRGERRFAYW 460 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 496 ICDTGYIPLPRSLTRYARSF 515 >SB_4934| Best HMM Match : NAD_binding_2 (HMM E-Value=4.8) Length = 186 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 81 PVGKPVVPAALMNRPTRGERRFAYW 105 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 448 VCVLGALPLPRSLTRCARSF 507 +C G +PLPRSLTR ARSF Sbjct: 141 ICDTGYIPLPRSLTRYARSF 160 >SB_4559| Best HMM Match : ICAM_N (HMM E-Value=5.3) Length = 244 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 22 PVGKPVVPAALMNRPTRGERRFAYW 46 >SB_3948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1112 Score = 56.0 bits (129), Expect = 2e-08 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 386 PVGKPVVPAALMNRPTRGXKRFAYW 460 PVGKPVVPAALMNRPTRG +RFAYW Sbjct: 586 PVGKPVVPAALMNRPTRGERRFAYW 610 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,275,551 Number of Sequences: 59808 Number of extensions: 305221 Number of successful extensions: 2112 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1442 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2112 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -