BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0364 (792 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g02650.1 68416.m00256 pentatricopeptide (PPR) repeat-containi... 30 1.5 At4g33985.1 68417.m04822 expressed protein 29 4.7 At2g45530.1 68415.m05662 zinc finger (C3HC4-type RING finger) fa... 28 8.2 >At3g02650.1 68416.m00256 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 1077 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +1 Query: 655 AYSNLERNCFDKNVGLSFNSFNILDINKQTLLR-MIFFEATS 777 A+ N+ FD N G + LDIN +T+LR ++ +EAT+ Sbjct: 362 AHGNISTVTFDSNSGQFYLPVINLDINTETVLRNLVAYEATN 403 >At4g33985.1 68417.m04822 expressed protein Length = 154 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 79 HEMRSRA*AEETWLRRKSHEELGMSGRAR 165 H A EE WLR+K + LG GR++ Sbjct: 19 HSWSPDADREEAWLRKKGKQSLGRLGRSK 47 >At2g45530.1 68415.m05662 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 240 Score = 27.9 bits (59), Expect = 8.2 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 4/62 (6%) Frame = +1 Query: 226 VPDQRPVLVHKGASPGKDCNVKCSDLLTDDITKAAKCAKKIYKRHR--FDAWYGWK--NH 393 +P ++ V + + S + C V D I +C + K HR DAW+ K N Sbjct: 56 IPPEKEVSLSRNGSSHEQCRVCLQDKEEVLIELGCQCRGGLAKAHRSCIDAWFRTKGSNQ 115 Query: 394 CQ 399 C+ Sbjct: 116 CE 117 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,470,694 Number of Sequences: 28952 Number of extensions: 296686 Number of successful extensions: 745 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 745 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1785055200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -