BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0362 (815 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 24 1.7 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 22 6.7 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 6.7 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 21 8.9 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 8.9 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +1 Query: 433 ICSEAKWTTLTLEIQRMPLISSTVGR 510 + ++KW + I+ MPL++ +GR Sbjct: 413 LAEDSKWRVRSAIIEYMPLLAGQLGR 438 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 490 ISSTVGRRTDSRTHKDSCQ 546 ISSTV R TD+ ++C+ Sbjct: 44 ISSTVSRNTDTYPTLETCR 62 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.8 bits (44), Expect = 6.7 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = +1 Query: 112 RTRLGDAIDKTSLKILKESYNLADDKNVIASPLGVMLLLSLYESGAG 252 + L A+D +L +NL K+ IA P ++L L + G Sbjct: 619 KINLKHALDLDRQGLLHRQFNLPPAKDTIAVPNNGYVVLRLRANNPG 665 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.4 bits (43), Expect = 8.9 Identities = 6/26 (23%), Positives = 15/26 (57%) Frame = +2 Query: 404 VGRRVLQDSESVQKRSGQH*LWRSKE 481 +G ++ ++ + ++ G H +W S E Sbjct: 358 IGVKIALEAATTEREGGYHDIWMSGE 383 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.4 bits (43), Expect = 8.9 Identities = 6/26 (23%), Positives = 15/26 (57%) Frame = +2 Query: 404 VGRRVLQDSESVQKRSGQH*LWRSKE 481 +G ++ ++ + ++ G H +W S E Sbjct: 358 IGVKIALEAATTEREGGYHDIWMSGE 383 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,393 Number of Sequences: 336 Number of extensions: 4252 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22310335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -