BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0361 (566 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24977| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_31855| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_31075| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_52479| Best HMM Match : Laminin_B (HMM E-Value=2.2) 28 6.1 >SB_24977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +3 Query: 201 SQKN*SKSPSSIFNIKSRTNSLSPSAKSKGVRFVSA 308 ++KN +K + + TNS SPS KSKG VSA Sbjct: 54 ARKNKAKDIEAYSTLYPETNSDSPSVKSKGALLVSA 89 >SB_31855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +3 Query: 201 SQKN*SKSPSSIFNIKSRTNSLSPSAKSKGVRFVSA 308 ++KN +K + + TNS SPS KSKG VSA Sbjct: 54 ARKNKAKDIEAYSTLYPETNSDSPSVKSKGALLVSA 89 >SB_31075| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +3 Query: 201 SQKN*SKSPSSIFNIKSRTNSLSPSAKSKGVRFVSA 308 ++KN +K + + TNS SPS KSKG VSA Sbjct: 54 ARKNKAKDIEAYSTLYPETNSDSPSVKSKGALLVSA 89 >SB_52479| Best HMM Match : Laminin_B (HMM E-Value=2.2) Length = 465 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/55 (23%), Positives = 30/55 (54%) Frame = -1 Query: 266 KRVSSGFNIEYRRGGFALIFLAEYSSILFIRMILVIINMGGYNLRFFFYLKLRLI 102 KR S+ F+ + GF +++ + + ++++NM GYN++ + K+ +I Sbjct: 289 KRSSTHFS-KILTEGFTYTIYDRFTNYVMVIETILVLNMTGYNVKVVYITKIFII 342 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,016,717 Number of Sequences: 59808 Number of extensions: 100373 Number of successful extensions: 184 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 184 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1337207630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -