BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0357 (659 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0015 + 6109552-6109650,6110006-6110078,6111937-6111998,611... 37 0.012 02_05_0473 + 29319824-29322511,29322659-29322820,29324133-293242... 33 0.20 09_04_0564 + 18565583-18566449,18569662-18570123 32 0.35 08_02_1172 + 24898290-24899141,24900864-24901328 32 0.35 06_03_0743 + 24069752-24070483,24071890-24072345 31 0.81 05_01_0042 - 290077-290676,291093-291233,291675-291764,292364-29... 31 0.81 01_07_0337 + 42838260-42838344,42838972-42839084,42839652-428397... 31 1.1 05_07_0110 - 27747789-27747897,27748375-27748568,27748811-277488... 30 1.9 11_06_0685 - 26272928-26273110,26273186-26273257,26273339-262734... 29 3.3 11_06_0459 + 23830204-23830350,23830419-23830592,23830738-238308... 29 3.3 11_06_0276 - 21826458-21826640,21826716-21826787,21826869-218269... 29 3.3 05_06_0126 - 25834129-25834214,25834595-25834658,25836201-258365... 29 3.3 05_01_0088 + 581619-581854,581890-582035,583143-583263,583593-58... 29 3.3 02_04_0194 + 20820985-20821027,20822168-20822367,20822477-208225... 29 3.3 03_02_0464 - 8683232-8684596 29 4.3 09_02_0226 - 6007656-6008063,6012166-6012678 28 5.7 03_06_0217 - 32432590-32433495 28 5.7 02_05_0288 - 27549718-27549940,27550025-27550102,27550282-275506... 28 5.7 04_04_0664 - 27066253-27067155,27067242-27067508,27067707-270683... 28 7.6 03_05_0796 + 27787401-27788831 28 7.6 >02_02_0015 + 6109552-6109650,6110006-6110078,6111937-6111998, 6112315-6112376,6112463-6112556,6112673-6113227, 6113379-6113870,6113967-6114137,6115713-6115817, 6115903-6116052,6116372-6116498,6116585-6116648, 6117147-6117203,6117423-6117555,6117660-6117746 Length = 776 Score = 37.1 bits (82), Expect = 0.012 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 2/59 (3%) Frame = +3 Query: 453 RNERVRQGLLYQRGGKRFPCKICARVYTHISNFCRHYVTSHKKDVKVFP--CPICFKEF 623 RNER+ +GLL KR C C + T+++ FC+ Y+T + ++ +P IC +F Sbjct: 10 RNERIIRGLLKLPANKR--CINCNNLTTNVATFCQIYITRYDLGLEQWPRGTTICLYKF 66 >02_05_0473 + 29319824-29322511,29322659-29322820,29324133-29324249, 29324360-29324469,29324504-29324540,29324696-29324862, 29325002-29325089,29325163-29325270 Length = 1158 Score = 33.1 bits (72), Expect = 0.20 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = +3 Query: 510 CKICARVYTHISNFCRHYVTSHKKDV----KVFPCPICFKEFTRKDNMIAHLK 656 CKIC++ ++ H+ HKK+V + + C +C FT + + H++ Sbjct: 465 CKICSQEFSDDQGLGLHWTEVHKKEVRWLFRGYSCAVCMDSFTNRRVLERHVQ 517 >09_04_0564 + 18565583-18566449,18569662-18570123 Length = 442 Score = 32.3 bits (70), Expect = 0.35 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 594 FPCPICFKEFTRKDNMIAHL 653 F CP+CFK F R +NM H+ Sbjct: 273 FSCPVCFKTFNRYNNMQMHM 292 >08_02_1172 + 24898290-24899141,24900864-24901328 Length = 438 Score = 32.3 bits (70), Expect = 0.35 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 594 FPCPICFKEFTRKDNMIAHL 653 F CP+CFK F R +NM H+ Sbjct: 268 FSCPVCFKTFNRYNNMQMHM 287 >06_03_0743 + 24069752-24070483,24071890-24072345 Length = 395 Score = 31.1 bits (67), Expect = 0.81 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 594 FPCPICFKEFTRKDNMIAHL 653 F CP+C+K F R +NM H+ Sbjct: 228 FSCPVCYKTFNRYNNMQMHM 247 >05_01_0042 - 290077-290676,291093-291233,291675-291764,292364-292563, 292685-292743,292827-292942 Length = 401 Score = 31.1 bits (67), Expect = 0.81 Identities = 18/69 (26%), Positives = 31/69 (44%), Gaps = 2/69 (2%) Frame = +3 Query: 456 NERVRQGLLYQRGGKRFPCKI--CARVYTHISNFCRHYVTSHKKDVKVFPCPICFKEFTR 629 + ++++ L G K F C C + ++ N H T ++ V P P C K FT Sbjct: 130 SSKLKRHHLIHTGQKDFICPHPGCGKAFSLDFNLRSHLKTHALENYHVCPFPACGKRFTS 189 Query: 630 KDNMIAHLK 656 + +H+K Sbjct: 190 DSKLKSHVK 198 >01_07_0337 + 42838260-42838344,42838972-42839084,42839652-42839729, 42839831-42840054,42840084-42840128,42840156-42840264 Length = 217 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/52 (28%), Positives = 22/52 (42%) Frame = +3 Query: 504 FPCKICARVYTHISNFCRHYVTSHKKDVKVFPCPICFKEFTRKDNMIAHLKI 659 FPC C + + C H H D + CP+C R +M AH ++ Sbjct: 37 FPCPFCY-IEVEVPFICNHLQEEHCFDTRNAVCPLCADNIGR--DMGAHFRV 85 >05_07_0110 - 27747789-27747897,27748375-27748568,27748811-27748888, 27749925-27750064,27750197-27750269 Length = 197 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/52 (26%), Positives = 23/52 (44%) Frame = +3 Query: 504 FPCKICARVYTHISNFCRHYVTSHKKDVKVFPCPICFKEFTRKDNMIAHLKI 659 F C C + +S C H H + PCPIC + + +M+ H+ + Sbjct: 42 FACPYCYEDHDVVS-LCAHLEEEHPFEPHAAPCPICSDKIAK--DMLNHITV 90 >11_06_0685 - 26272928-26273110,26273186-26273257,26273339-26273425, 26273566-26273655,26273741-26273785,26273872-26274054, 26274333-26274392,26274521-26274703,26274779-26274907, 26275083-26275380,26275454-26275608,26275791-26275929, 26276015-26276096,26276167-26276285,26276367-26276494, 26276640-26276813,26276882-26277028 Length = 757 Score = 29.1 bits (62), Expect = 3.3 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +2 Query: 2 IKQEPNNDANDGYNEPIEYKYNPERS--RENSNSQDGP-IKDSDEK 130 +K+EP N+++D Y K ERS R S P I DSD K Sbjct: 422 VKEEPKNESSDDYEMNNHRKTKKERSNMRSTKRSNKEPYITDSDGK 467 >11_06_0459 + 23830204-23830350,23830419-23830592,23830738-23830865, 23830947-23831065,23831136-23831217,23831303-23831441, 23831624-23831778,23831852-23832149,23832325-23832453, 23832529-23832711,23832840-23832899,23832973-23833101, 23833177-23833359,23833446-23833490,23833576-23833665, 23833806-23833892,23833974-23834045,23834120-23834302 Length = 800 Score = 29.1 bits (62), Expect = 3.3 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +2 Query: 2 IKQEPNNDANDGYNEPIEYKYNPERS--RENSNSQDGP-IKDSDEK 130 +K+EP N+++D Y K ERS R S P I DSD K Sbjct: 422 VKEEPKNESSDDYEMNNHRKTKKERSNMRSTKRSNKEPYITDSDGK 467 >11_06_0276 - 21826458-21826640,21826716-21826787,21826869-21826955, 21827096-21827185,21827271-21827315,21827402-21827584, 21827660-21827788,21827862-21827921,21828050-21828232, 21828308-21828436,21828612-21828909,21828983-21829137, 21829320-21829458,21829544-21829625,21829696-21829814, 21829896-21830023,21830169-21830342,21830411-21830557 Length = 800 Score = 29.1 bits (62), Expect = 3.3 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +2 Query: 2 IKQEPNNDANDGYNEPIEYKYNPERS--RENSNSQDGP-IKDSDEK 130 +K+EP N+++D Y K ERS R S P I DSD K Sbjct: 422 VKEEPKNESSDDYEMNNHRKTKKERSNMRSTKRSNKEPYITDSDGK 467 >05_06_0126 - 25834129-25834214,25834595-25834658,25836201-25836521, 25836912-25837040,25837118-25837177,25837251-25837548, 25837622-25837776,25837959-25838097,25838185-25838266, 25838337-25838455,25838537-25838664,25838810-25838983, 25839052-25839203,25839393-25839425,25840362-25841331, 25841412-25841537 Length = 1011 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 2 IKQEPNNDANDGYNEPIEYKYNPERSRENSNSQDGPIKD 118 +K+EP N+++D Y + K ERS S + + D Sbjct: 820 VKEEPKNESSDDYEKNNHRKTKKERSNMRSTKRSKKVTD 858 >05_01_0088 + 581619-581854,581890-582035,583143-583263,583593-583773, 583842-584015,584161-584288,584370-584488,584559-584640, 584726-584864,585047-585201,585275-585572,585748-585876, 585952-586134,586263-586322,586396-586524,586600-586782, 586869-586913,586999-587088,587229-587315,587397-587468, 587813-587887 Length = 943 Score = 29.1 bits (62), Expect = 3.3 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +2 Query: 2 IKQEPNNDANDGYNEPIEYKYNPERS--RENSNSQDGP-IKDSDEK 130 +K+EP N+++D Y K ERS R S P I DSD K Sbjct: 601 VKEEPKNESSDDYEMNNHRKTKKERSNMRSTKRSNKEPYITDSDGK 646 >02_04_0194 + 20820985-20821027,20822168-20822367,20822477-20822566, 20822820-20822825,20822866-20823009,20823089-20823580 Length = 324 Score = 29.1 bits (62), Expect = 3.3 Identities = 18/71 (25%), Positives = 35/71 (49%), Gaps = 4/71 (5%) Frame = +3 Query: 456 NERVRQGLLYQRGGKRFPC--KICARVYTHISNF-CRHYVTSHKKD-VKVFPCPICFKEF 623 + ++++ L G K F C + C +V +F + ++ +H D V P C + F Sbjct: 86 SSKLKRHFLIHTGEKNFVCPHEGCGKVLAFSLDFNLKAHMKTHSVDNYHVCKYPECARRF 145 Query: 624 TRKDNMIAHLK 656 T++ + AH+K Sbjct: 146 TQESKLRAHIK 156 >03_02_0464 - 8683232-8684596 Length = 454 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/46 (28%), Positives = 18/46 (39%) Frame = +3 Query: 438 RQLPRRNERVRQGLLYQRGGKRFPCKICARVYTHISNFCRHYVTSH 575 RQ+P+ R + G FPCK+C V + H H Sbjct: 187 RQIPQATTRQSSFRSFAARGDVFPCKVCGEVLSKPQQLELHQAMKH 232 >09_02_0226 - 6007656-6008063,6012166-6012678 Length = 306 Score = 28.3 bits (60), Expect = 5.7 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 594 FPCPICFKEFTRKDNMIAHL 653 F CP+C K F+R +N+ H+ Sbjct: 155 FACPVCCKTFSRYNNLQMHM 174 >03_06_0217 - 32432590-32433495 Length = 301 Score = 28.3 bits (60), Expect = 5.7 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 579 KDVKVFPCPICFKEFTRKDNMIAH 650 KDV++FPC C K+F + + H Sbjct: 44 KDVRLFPCLFCNKKFLKSQALGGH 67 >02_05_0288 - 27549718-27549940,27550025-27550102,27550282-27550674, 27550752-27551347,27552232-27552978 Length = 678 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +2 Query: 425 IWVVSAITTKKRTSPSGTIVSKRGKTFSMQNMCKGLYTH 541 +WV++ + T +S G +V +RG S Q+ C+G+ T+ Sbjct: 549 LWVMNMVPTVGNSSTLG-VVYERGLIGSYQDWCEGMSTY 586 >04_04_0664 - 27066253-27067155,27067242-27067508,27067707-27068368, 27068479-27069047,27070011-27070108 Length = 832 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +2 Query: 5 KQEPNNDANDGYNEPIEYKYNP-ERSRENSNSQDGPIKDS 121 ++ +ND NDG E +E + N +S E S S D DS Sbjct: 306 EENTDNDGNDGNEEHVENEENEGNKSGEGSLSSDDDSSDS 345 >03_05_0796 + 27787401-27788831 Length = 476 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +3 Query: 486 QRGGKRFPCKICARVYTHISNFCRHYVTSHKKDVK 590 +R KRF C IC R + H V HKK K Sbjct: 241 ERASKRFVCSICGRCFGSHQALGGH-VLGHKKKAK 274 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,998,518 Number of Sequences: 37544 Number of extensions: 336735 Number of successful extensions: 942 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 909 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 942 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1655832080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -