BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0353 (557 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 6.8 AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 23 9.0 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.0 bits (47), Expect = 6.8 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -1 Query: 335 CENPSGFIYRISKTDLSKVGLFCMYFNQCH*KYH 234 CE+PS YR + S G + +C YH Sbjct: 497 CEHPSDPEYRERADECSNAGTYKCGICECDGTYH 530 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 22.6 bits (46), Expect = 9.0 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +3 Query: 222 ILCIVIFLMTLIEVHTK 272 +LC+V +TL+E+ TK Sbjct: 89 LLCLVTMPLTLVEILTK 105 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 489,669 Number of Sequences: 2352 Number of extensions: 8911 Number of successful extensions: 49 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52142868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -