BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0353 (557 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00067-1|AAK20074.1| 305|Caenorhabditis elegans Hypothetical pr... 29 2.3 AF040661-5|AAG24212.1| 209|Caenorhabditis elegans Hypothetical ... 27 9.1 >U00067-1|AAK20074.1| 305|Caenorhabditis elegans Hypothetical protein F54E7.5 protein. Length = 305 Score = 29.1 bits (62), Expect = 2.3 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 183 YLLIICYVL*QITILCIVIFLMTL 254 +LLI C +L +T CI++F +TL Sbjct: 187 HLLIACLILLCLTTFCIIVFFITL 210 >AF040661-5|AAG24212.1| 209|Caenorhabditis elegans Hypothetical protein W10G11.3 protein. Length = 209 Score = 27.1 bits (57), Expect = 9.1 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +2 Query: 92 TKS*EYCSNFDQCEDTLSIIKYKIQSIVTYVLTNNMLC 205 TK E C NF++C TL K+ +IV V T M C Sbjct: 75 TKVIEICINFNRCRQTLDCQPDKVFAIV--VNTGLMFC 110 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,798,882 Number of Sequences: 27780 Number of extensions: 202889 Number of successful extensions: 432 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 430 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 432 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1144922904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -