BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0351 (732 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 25 3.2 AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical prot... 23 7.4 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 24.6 bits (51), Expect = 3.2 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = -2 Query: 692 LGFIV*AHHIFTVGIDIDTRAYLTSATIIIAVPTGIKIFR*LATIHGTQINYNPNI 525 L F+V A T+GID+ A L + ++ A+ T + I L TI G I N+ Sbjct: 216 LDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT-VAIVPGLKTIVGAVIESVKNL 270 >AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical protein protein. Length = 278 Score = 23.4 bits (48), Expect = 7.4 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 39 AGGKF*YHSIDDGRFKENKL 98 A GK+ YH DDG E L Sbjct: 121 ANGKYVYHDQDDGLLDERYL 140 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 509,763 Number of Sequences: 2352 Number of extensions: 8702 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -