Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVm0348
         (724 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292363-1|CAL23175.2|  347|Tribolium castaneum gustatory recept...    22   4.4  
AM712901-1|CAN84640.1|  205|Tribolium castaneum hypothetical pro...    21   7.6  

>AM292363-1|CAL23175.2|  347|Tribolium castaneum gustatory receptor
           candidate 42 protein.
          Length = 347

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 8/36 (22%), Positives = 18/36 (50%)
 Frame = -3

Query: 287 FIK*KENIICTSIKTKE*FQNIVGWLLFLSLIFISV 180
           F K  E ++C+  +    F    GW + + +++ S+
Sbjct: 190 FAKKMEGLVCSIKELNMIFNEFFGWPIIMIILYSSL 225


>AM712901-1|CAN84640.1|  205|Tribolium castaneum hypothetical
           protein protein.
          Length = 205

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -1

Query: 112 YIY*CSNNLNI 80
           Y+Y C NN N+
Sbjct: 159 YVYCCDNNFNV 169


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 169,431
Number of Sequences: 336
Number of extensions: 3810
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 19259425
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)