BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0347 (567 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 26 0.30 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 23 2.1 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 23 2.1 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 23 2.1 AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. 23 2.8 AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. 23 2.8 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 2.8 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 22 4.9 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 4.9 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 4.9 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 4.9 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 6.5 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 6.5 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 8.6 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 21 8.6 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 8.6 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 21 8.6 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 25.8 bits (54), Expect = 0.30 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = -2 Query: 458 SFRAMEIVVKYSQQQNHYHHTDEAGERY*VRCYPFWDKSSD 336 S ++ E+ + + + ERY VRCYP +D +++ Sbjct: 429 SVKSSELSISWDAPITEIGGDSDLVERYEVRCYPRYDDATN 469 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.0 bits (47), Expect = 2.1 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 375 ITFAGFVCMVIVILLLTIFDYDFHGAER 458 IT+ G+V + L+ TIF+ D+ A R Sbjct: 366 ITWLGYVNSALNPLIYTIFNLDYRRAFR 393 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.0 bits (47), Expect = 2.1 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 375 ITFAGFVCMVIVILLLTIFDYDFHGAER 458 IT+ G+V + L+ TIF+ D+ A R Sbjct: 366 ITWLGYVNSALNPLIYTIFNLDYRRAFR 393 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 23.0 bits (47), Expect = 2.1 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 375 ITFAGFVCMVIVILLLTIFDYDFHGAER 458 IT+ G+V + L+ TIF+ D+ A R Sbjct: 366 ITWLGYVNSALNPLIYTIFNLDYRRAFR 393 >AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. Length = 136 Score = 22.6 bits (46), Expect = 2.8 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +2 Query: 473 RRIQDTELGVNGCGVL 520 R+ DT +GV+GC ++ Sbjct: 101 RQCNDTSIGVDGCDLM 116 >AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. Length = 135 Score = 22.6 bits (46), Expect = 2.8 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +2 Query: 473 RRIQDTELGVNGCGVL 520 R+ DT +GV+GC ++ Sbjct: 102 RQCNDTSIGVDGCDLM 117 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.6 bits (46), Expect = 2.8 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -2 Query: 428 YSQQQNHYHHTDEAGE 381 Y QQQ HH D + E Sbjct: 98 YLQQQQQQHHQDSSSE 113 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.8 bits (44), Expect = 4.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -2 Query: 110 FDLNTSLYANLTFFR 66 FDL S Y NLTF R Sbjct: 212 FDLMGSPYRNLTFVR 226 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 4.9 Identities = 12/42 (28%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 1 LYESACS-VNKIIITIQNSNV*IRKNVKLA*SEVFKSNVTNE 123 LY+ S NK++ + N++ +R +KL S++ N+ N+ Sbjct: 32 LYDDLLSNYNKLVRPVVNTSDVLRVCIKLKLSQLIDVNLKNQ 73 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 4.9 Identities = 12/42 (28%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 1 LYESACS-VNKIIITIQNSNV*IRKNVKLA*SEVFKSNVTNE 123 LY+ S NK++ + N++ +R +KL S++ N+ N+ Sbjct: 32 LYDDLLSNYNKLVRPVVNTSDVLRVCIKLKLSQLIDVNLKNQ 73 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 4.9 Identities = 7/28 (25%), Positives = 17/28 (60%) Frame = +3 Query: 141 ISKYYQHLLTLESCQDLKETYNDHGKTL 224 ++ Y + ++ C ++ E+Y+ + KTL Sbjct: 643 LNVYPEFQENVQLCSEISESYSSNNKTL 670 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.4 bits (43), Expect = 6.5 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -2 Query: 317 HNIVAKRACVDGAVLI 270 HN+V K AC G + Sbjct: 114 HNLVGKEACKQGVCTV 129 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.4 bits (43), Expect = 6.5 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -2 Query: 317 HNIVAKRACVDGAVLI 270 HN+V K AC G + Sbjct: 114 HNLVGKEACKQGVCTV 129 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 68 GKMLN*RKVKCSNRM*RTKII 130 GK+ +KV+ SN M + K+I Sbjct: 257 GKLKPNKKVRISNEMSKVKVI 277 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 319 CIT*LLSGLVSMALYLYFLSPSNG 248 C+T L SG+V Y + S+G Sbjct: 409 CVTLLFSGIVGFGAYCAAHTDSSG 432 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -2 Query: 380 RY*VRCYPFWDKSSDKVPTRMHNIV 306 +Y ++ +PF DK+PT + N + Sbjct: 881 KYALKFFPFDKHILDKLPTLISNYI 905 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 319 CIT*LLSGLVSMALYLYFLSPSNG 248 C+T L SG+V Y + S+G Sbjct: 409 CVTLLFSGIVGFGAYCAAHTDSSG 432 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,220 Number of Sequences: 438 Number of extensions: 3139 Number of successful extensions: 20 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16440594 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -