BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0345 (730 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13F5.06c |sec10||exocyst complex subunit Sec10|Schizosacchar... 26 4.8 SPAC6G9.06c |pcp1||pericentrin Pcp1|Schizosaccharomyces pombe|ch... 26 6.3 SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccha... 25 8.4 >SPAC13F5.06c |sec10||exocyst complex subunit Sec10|Schizosaccharomyces pombe|chr 1|||Manual Length = 811 Score = 26.2 bits (55), Expect = 4.8 Identities = 16/62 (25%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = -3 Query: 689 TKNNAEDKVPEVEAALRTFGNCLKGLVDLNVLKTEIEEAKPN--GALDEVFKKYCDKSAQ 516 T+N+ K+ ++ ++++F CL +LN LK+ + + + A +V +Y KS Sbjct: 40 TQNDGSKKLSSIDGSIKSFAACLH---ELNRLKSRVGDRIRDYASASKQVQNEYHQKSNH 96 Query: 515 LK 510 L+ Sbjct: 97 LR 98 >SPAC6G9.06c |pcp1||pericentrin Pcp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1208 Score = 25.8 bits (54), Expect = 6.3 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -2 Query: 465 NEYANHINDAQNSTNQLIDFVCYKDGD 385 +EY N + D + + N++++ YKD D Sbjct: 569 DEYRNKLKDKEETYNEVMNAFQYKDND 595 >SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 846 Score = 25.4 bits (53), Expect = 8.4 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 261 SSYWRIPQWGSSVSNLKSMS*DSQSFAGSTQGRLP 365 SS R+ + S++S+LKS SQ+ GST +P Sbjct: 379 SSLNRVASFESNISSLKSALYASQNSDGSTSNPVP 413 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,870,587 Number of Sequences: 5004 Number of extensions: 56871 Number of successful extensions: 169 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 169 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 343230174 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -