BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0344 (748 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 25 0.85 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 23 2.0 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 23 2.6 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 24.6 bits (51), Expect = 0.85 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +1 Query: 595 KRSCRTVYHISASQPKYTTLCAQ*RMLNVLIRLG 696 KR R VY I S+PKY +L+ RLG Sbjct: 118 KRFLRGVYRIKPSKPKYDVTWDPAVVLDYFERLG 151 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 331 SGILSGNGNQYGDF 372 S ILS N N YGDF Sbjct: 349 SSILSPNRNYYGDF 362 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +2 Query: 470 TISFTADIISGVIYRYGSQSSAVFQS 547 T+SF +++ G++ G+ S V +S Sbjct: 211 TVSFGTNLVGGIVRSLGTLGSRVVES 236 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,720 Number of Sequences: 336 Number of extensions: 4279 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -