BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0344 (748 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 4.0 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 9.3 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 21 9.3 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 9.3 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 9.3 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 458 YFCSSPKLMMSEARQYFPRTAAS 390 +F +SP+L + +YF RT S Sbjct: 241 FFSTSPELSNKQRFEYFTRTIPS 263 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.4 bits (43), Expect = 9.3 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 449 SSPKLMMSEARQYFPRTAASMLRHSSKSPYWFPLP 345 S K++ S +R+Y R ++S++ S S P P Sbjct: 12 SQRKIIRSRSRRYSKRFSSSIVDRRSPSSSRSPSP 46 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/29 (27%), Positives = 17/29 (58%) Frame = +2 Query: 647 QHYVHSEEC*TSLFVWESLVHIFLLSDTA 733 +H+ +SEE ++ +W+ + + L D A Sbjct: 209 KHFTNSEEAPGNMGLWDQALALRWLRDNA 237 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/29 (27%), Positives = 17/29 (58%) Frame = +2 Query: 647 QHYVHSEEC*TSLFVWESLVHIFLLSDTA 733 +H+ +SEE ++ +W+ + + L D A Sbjct: 209 KHFTNSEEAPGNMGLWDQALALRWLRDNA 237 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 9.3 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -3 Query: 458 YFCSSPKLMMSEARQYFPRTAASMLRHSSKSP 363 YFC KL + P++ +S S++SP Sbjct: 428 YFCLDGKLPHDDQPPLSPQSDSSSSSRSAESP 459 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 222,689 Number of Sequences: 438 Number of extensions: 5002 Number of successful extensions: 22 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -