BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0343 (776 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A6ECR4 Cluster: Alpha-mannosidase; n=1; Pedobacter sp. ... 34 3.4 UniRef50_UPI00006CD063 Cluster: conserved hypothetical protein; ... 33 8.0 UniRef50_P70665 Cluster: Sialate O-acetylesterase precursor (EC ... 33 8.0 >UniRef50_A6ECR4 Cluster: Alpha-mannosidase; n=1; Pedobacter sp. BAL39|Rep: Alpha-mannosidase - Pedobacter sp. BAL39 Length = 879 Score = 34.3 bits (75), Expect = 3.4 Identities = 18/60 (30%), Positives = 28/60 (46%) Frame = +1 Query: 235 PDISWQDTCKWNHNSLITNVRNQGREFTRKNPANFCL*NAAVYLLYYIERDYHPMTVSTT 414 P +W+ N +T N G KNP CL +A Y ++++D++ TV TT Sbjct: 204 PGSTWETMASTNSKEYVTAALNDGI----KNPVGMCLQDAGWYFGPWLKKDFYQPTVYTT 259 >UniRef50_UPI00006CD063 Cluster: conserved hypothetical protein; n=1; Tetrahymena thermophila SB210|Rep: conserved hypothetical protein - Tetrahymena thermophila SB210 Length = 737 Score = 33.1 bits (72), Expect = 8.0 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = +1 Query: 181 CYYQLVPYKLNNSLYYSFPDISW--QDTCKWNHNSLITNVRNQGREFTRKNPANF 339 C + V + N Y F + + Q+ CKW++ ++ +R Q R+F K P N+ Sbjct: 131 CLFIFVEVQARNQQIYQFNFLHYKKQEFCKWDNKPIMMQIRFQMRQFV-KYPVNY 184 >UniRef50_P70665 Cluster: Sialate O-acetylesterase precursor (EC 3.1.1.53) (Sialic acid-specific 9-O-acetylesterase) (Yolk sac protein 2) [Contains: Sialate O- acetylesterase small subunit; Sialate O-acetylesterase large subunit]; n=9; Euarchontoglires|Rep: Sialate O-acetylesterase precursor (EC 3.1.1.53) (Sialic acid-specific 9-O-acetylesterase) (Yolk sac protein 2) [Contains: Sialate O- acetylesterase small subunit; Sialate O-acetylesterase large subunit] - Mus musculus (Mouse) Length = 541 Score = 33.1 bits (72), Expect = 8.0 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 184 YYQLVPYKLNNSLYYSFPDISWQDTCKWNH 273 + QL Y L NS Y FP+I W T + H Sbjct: 346 FVQLSSYMLKNSSDYGFPEIRWHQTADFGH 375 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 643,059,531 Number of Sequences: 1657284 Number of extensions: 12475854 Number of successful extensions: 21915 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21084 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21903 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 65438977305 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -