BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0343 (776 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_1175 - 10094144-10094387,10094573-10094730,10094851-100950... 29 5.4 >06_01_1175 - 10094144-10094387,10094573-10094730,10094851-10095055, 10095184-10095473,10095605-10095770,10095872-10095960, 10096060-10096127,10097185-10097473 Length = 502 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +1 Query: 196 VPYKLNNSLYYSFPDISWQDTCKWNHNSLITNVR 297 V ++ + +Y+S P ISW D + HN ++ +R Sbjct: 178 VKRRVEHGMYHSMPPISWSD-ISYYHNQILPLIR 210 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,761,908 Number of Sequences: 37544 Number of extensions: 279101 Number of successful extensions: 378 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 376 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 378 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2080154268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -