BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0342 (762 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032637-15|CAA21616.2| 370|Caenorhabditis elegans Hypothetical... 29 4.8 AF022971-12|AAG23974.3| 229|Caenorhabditis elegans Hypothetical... 28 6.3 AC024777-5|AAF60564.1| 506|Caenorhabditis elegans Hypothetical ... 28 6.3 >AL032637-15|CAA21616.2| 370|Caenorhabditis elegans Hypothetical protein Y43F8C.16 protein. Length = 370 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -2 Query: 659 TSTRPGTGASASRPNPTRPGPQSQSLFRSYGSNLPTSLT 543 TST P T S + P P+ P S SNL ++LT Sbjct: 297 TSTVPSTTTSTTTPKPSSPSTAEASTTPVLTSNLTSALT 335 >AF022971-12|AAG23974.3| 229|Caenorhabditis elegans Hypothetical protein C31B8.1 protein. Length = 229 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -2 Query: 641 TGASASRPNPTRPGPQSQSLFRSYGSNLPTSLTYIILSTRGSSP 510 T A +P + P +Q LF S+G LP I + SSP Sbjct: 11 TMAITRSKSPFKASPSNQKLFISFGVGLPIFFQMCIFTASYSSP 54 >AC024777-5|AAF60564.1| 506|Caenorhabditis elegans Hypothetical protein Y42H9AR.1 protein. Length = 506 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = -3 Query: 667 THEHRPDPAPA---HPLPVQTRHAPVLRANP 584 +HEH P PAPA P PVQ +A P Sbjct: 330 SHEHSPSPAPAPVSSPTPVQQYQQSYSQAQP 360 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,340,225 Number of Sequences: 27780 Number of extensions: 425107 Number of successful extensions: 1383 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1222 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1381 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1819579054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -