BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0340 (717 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 24 1.4 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 22 5.7 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 7.6 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 23.8 bits (49), Expect = 1.4 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 5/35 (14%) Frame = -1 Query: 252 DNKPFGYPFDRPVLP-----QYFKQPNMFFKKVLV 163 D + GYPFDR Q F PNM ++V++ Sbjct: 635 DRRSMGYPFDRMPRDGVDTLQQFLTPNMRVQEVVI 669 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.8 bits (44), Expect = 5.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -1 Query: 252 DNKPFGYPFDR 220 D + GYPFDR Sbjct: 636 DRRSMGYPFDR 646 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.4 bits (43), Expect = 7.6 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -2 Query: 299 YEPTPKESEPFKSVVRTTNHSVIHS 225 Y P ES PF ++ T+H I S Sbjct: 157 YSRHPYESWPFNTMSGATHHGGIKS 181 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,385 Number of Sequences: 336 Number of extensions: 3721 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19051215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -