BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0340 (717 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 112 3e-25 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 110 1e-24 SB_50168| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_40846| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_33362| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_36790| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 4e-14 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 75 4e-14 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 4e-14 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 75 8e-14 SB_59174| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_59049| Best HMM Match : NUMOD1 (HMM E-Value=6) 75 8e-14 SB_18725| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_14049| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_7317| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 74 1e-13 SB_38587| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_35762| Best HMM Match : Beta-lactamase (HMM E-Value=7.2e-05) 74 1e-13 SB_42207| Best HMM Match : Ank (HMM E-Value=6.3) 74 1e-13 SB_41480| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_38636| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 74 1e-13 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 74 1e-13 SB_33616| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_31742| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_30562| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_26344| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_11590| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_9170| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 74 1e-13 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_1641| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_59544| Best HMM Match : Secretin_N_2 (HMM E-Value=7.9) 74 1e-13 SB_56976| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 74 1e-13 SB_55903| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_55293| Best HMM Match : Hemopexin (HMM E-Value=6.7) 74 1e-13 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 74 1e-13 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_41348| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_38671| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 74 1e-13 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 74 1e-13 SB_36182| Best HMM Match : Fic (HMM E-Value=2.3e-19) 74 1e-13 SB_34299| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_34022| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_33552| Best HMM Match : MIF (HMM E-Value=9.7) 74 1e-13 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_24533| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 74 1e-13 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 74 1e-13 SB_17826| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_16932| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_16803| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_14402| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_13755| Best HMM Match : Cyto_ox_2 (HMM E-Value=5.5e-09) 74 1e-13 SB_13220| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_10480| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_10241| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_9002| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_6812| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_5020| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_3366| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 73 3e-13 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_37138| Best HMM Match : RnaseA (HMM E-Value=8) 62 4e-10 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 60 1e-09 SB_56823| Best HMM Match : Rhabdo_NV (HMM E-Value=7.4) 60 2e-09 SB_54715| Best HMM Match : Hexapep (HMM E-Value=1.2e-05) 60 2e-09 SB_50679| Best HMM Match : Tombus_P19 (HMM E-Value=2.1) 60 2e-09 SB_35269| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_33473| Best HMM Match : GST_N (HMM E-Value=0.028) 60 2e-09 SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) 60 2e-09 SB_8585| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_4893| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_3631| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_40844| Best HMM Match : DUF595 (HMM E-Value=6.1) 60 2e-09 SB_38057| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_26734| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_7597| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2) 60 2e-09 SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) 59 3e-09 SB_13637| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) 59 4e-09 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 59 4e-09 SB_8316| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 58 5e-09 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 58 5e-09 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 58 5e-09 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_44687| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 58 7e-09 SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) 58 7e-09 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 58 7e-09 SB_10448| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 58 7e-09 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 58 7e-09 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 58 7e-09 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 58 9e-09 SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 9e-09 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 58 9e-09 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 9e-09 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 9e-09 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 58 9e-09 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 58 9e-09 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 57 1e-08 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 57 1e-08 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 57 1e-08 SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) 57 1e-08 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 57 1e-08 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 57 1e-08 SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 57 1e-08 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 57 1e-08 SB_18550| Best HMM Match : DUF987 (HMM E-Value=4.4) 57 1e-08 SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) 57 1e-08 SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) 57 1e-08 SB_5006| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_864| Best HMM Match : Sulfotransfer_1 (HMM E-Value=6.4e-05) 57 1e-08 SB_857| Best HMM Match : Mago_nashi (HMM E-Value=0) 57 1e-08 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) 57 2e-08 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 57 2e-08 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 57 2e-08 SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) 57 2e-08 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 57 2e-08 SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 57 2e-08 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) 57 2e-08 SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 57 2e-08 SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 57 2e-08 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 57 2e-08 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 57 2e-08 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) 57 2e-08 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 57 2e-08 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 57 2e-08 SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) 57 2e-08 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 57 2e-08 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 57 2e-08 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 57 2e-08 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 57 2e-08 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 57 2e-08 SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) 57 2e-08 SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) 57 2e-08 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) 57 2e-08 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 57 2e-08 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 57 2e-08 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) 57 2e-08 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 57 2e-08 SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 57 2e-08 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 57 2e-08 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 57 2e-08 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) 57 2e-08 SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) 57 2e-08 SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) 57 2e-08 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 57 2e-08 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) 57 2e-08 SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 57 2e-08 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 57 2e-08 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 57 2e-08 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 57 2e-08 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 57 2e-08 SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) 57 2e-08 SB_10073| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 57 2e-08 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 57 2e-08 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 57 2e-08 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 57 2e-08 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 57 2e-08 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 57 2e-08 SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 57 2e-08 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 57 2e-08 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_56846| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_55386| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 57 2e-08 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 57 2e-08 SB_52605| Best HMM Match : UPF0004 (HMM E-Value=3.6) 57 2e-08 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_51037| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 57 2e-08 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_47765| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08) 57 2e-08 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 57 2e-08 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 57 2e-08 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_42773| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_42727| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 57 2e-08 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 57 2e-08 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_39698| Best HMM Match : Rho_RNA_bind (HMM E-Value=3.4) 57 2e-08 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 57 2e-08 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 57 2e-08 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 57 2e-08 SB_38298| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_37805| Best HMM Match : DoxA (HMM E-Value=1.7) 57 2e-08 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 57 2e-08 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 57 2e-08 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 57 2e-08 SB_34031| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_33876| Best HMM Match : EGF (HMM E-Value=2.4e-08) 57 2e-08 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 57 2e-08 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 57 2e-08 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29112| Best HMM Match : Mucin (HMM E-Value=1.7) 57 2e-08 SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_27070| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) 57 2e-08 SB_26142| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) 57 2e-08 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 57 2e-08 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 57 2e-08 SB_21148| Best HMM Match : PAN (HMM E-Value=0.49) 57 2e-08 SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_20517| Best HMM Match : Nuclease_act (HMM E-Value=1.4) 57 2e-08 SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) 57 2e-08 SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) 57 2e-08 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_18568| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.5e-22) 57 2e-08 SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) 57 2e-08 SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_17258| Best HMM Match : DUF791 (HMM E-Value=0.002) 57 2e-08 SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_16872| Best HMM Match : ARM_1 (HMM E-Value=0) 57 2e-08 SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) 57 2e-08 SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) 57 2e-08 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 57 2e-08 SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 57 2e-08 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) 57 2e-08 SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_11965| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_11390| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_11195| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_10723| Best HMM Match : Chromo (HMM E-Value=0.031) 57 2e-08 SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_10590| Best HMM Match : DUF485 (HMM E-Value=7.3) 57 2e-08 SB_10325| Best HMM Match : ubiquitin (HMM E-Value=3.4e-05) 57 2e-08 SB_9530| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_9135| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_8821| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_8089| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_6860| Best HMM Match : zf-C3HC4 (HMM E-Value=0.14) 57 2e-08 SB_6524| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_6458| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_6296| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) 57 2e-08 SB_5755| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_5051| Best HMM Match : DUF1193 (HMM E-Value=0.88) 57 2e-08 SB_4934| Best HMM Match : NAD_binding_2 (HMM E-Value=4.8) 57 2e-08 SB_4559| Best HMM Match : ICAM_N (HMM E-Value=5.3) 57 2e-08 SB_3953| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_3948| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_3585| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_3444| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_3301| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_3169| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_2599| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_1434| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_742| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 56 2e-08 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 56 2e-08 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 56 2e-08 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 56 2e-08 SB_19170| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 56 2e-08 SB_16558| Best HMM Match : SoxE (HMM E-Value=8.2) 56 2e-08 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 56 2e-08 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_53938| Best HMM Match : Gln-synt_N (HMM E-Value=0.78) 56 2e-08 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_36434| Best HMM Match : Ins_allergen_rp (HMM E-Value=5.7) 56 2e-08 SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_9823| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_6133| Best HMM Match : ABC_tran (HMM E-Value=9e-09) 56 2e-08 SB_870| Best HMM Match : 7tm_1 (HMM E-Value=5.3e-09) 56 2e-08 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 56 3e-08 SB_27029| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_52226| Best HMM Match : Cytadhesin_P30 (HMM E-Value=9) 56 4e-08 SB_46539| Best HMM Match : Keratin_B2 (HMM E-Value=1.2) 56 4e-08 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 56 4e-08 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_32717| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_22087| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_18481| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_12188| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_43936| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 55 5e-08 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 55 5e-08 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_33112| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_31147| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_21178| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_10549| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_9649| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 55 5e-08 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 112 bits (269), Expect = 3e-25 Identities = 51/52 (98%), Positives = 51/52 (98%) Frame = +3 Query: 510 SRETCRASCINESANARGEAVCVLGALPLPRSLTRCARXFGCGERYQLTQRR 665 SRETCRASCINESANARGEAVCVLGALPLPRSLTRCAR FGCGERYQLTQRR Sbjct: 92 SRETCRASCINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 143 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 110 bits (265), Expect = 1e-24 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = +3 Query: 513 RETCRASCINESANARGEAVCVLGALPLPRSLTRCARXFGCGERYQLTQRR 665 RETCRASCINESANARGEAVCVLGALPLPRSLTRCAR FGCGERYQLTQRR Sbjct: 457 RETCRASCINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 507 >SB_50168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 79.0 bits (186), Expect = 4e-15 Identities = 35/43 (81%), Positives = 36/43 (83%) Frame = +1 Query: 307 TNTNSWKGNPSWYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 T S NP+ YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 61 TVEGSTLANPNGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 103 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 77.4 bits (182), Expect = 1e-14 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +1 Query: 328 GNPSWYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 GN YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 189 GNADGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 224 >SB_40846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 75.8 bits (178), Expect = 3e-14 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 322 WKGNPSWYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 W + YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 51 WAVRANGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 88 >SB_33362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 75.8 bits (178), Expect = 3e-14 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +1 Query: 334 PSWYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 P YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 113 PKGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 146 >SB_36790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 75.4 bits (177), Expect = 4e-14 Identities = 36/49 (73%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = +1 Query: 292 GSYG*TNTNSWKG-NPSWYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 G G +N K N YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 9 GGAGFIGSNIVKALNDKGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 57 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 75.4 bits (177), Expect = 4e-14 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +1 Query: 331 NPSWYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 N + YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 184 NTTGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 218 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 75.4 bits (177), Expect = 4e-14 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +1 Query: 334 PSWYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 P YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 147 PHGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 180 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 74.5 bits (175), Expect = 8e-14 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 337 SWYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 S YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 109 SGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 141 >SB_59174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 74.5 bits (175), Expect = 8e-14 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +1 Query: 325 KGNPSWYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 +G+ YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 24 EGDGVGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 60 >SB_59049| Best HMM Match : NUMOD1 (HMM E-Value=6) Length = 77 Score = 74.5 bits (175), Expect = 8e-14 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 337 SWYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 S YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 45 SGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 77 >SB_18725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 74.5 bits (175), Expect = 8e-14 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 337 SWYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 S YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 73 SGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 105 >SB_14049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 74.5 bits (175), Expect = 8e-14 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 337 SWYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 S YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 98 SGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 130 >SB_7317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 74.5 bits (175), Expect = 8e-14 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA*SVKPGVPNE 465 YRARI NH SC LCEIVIRS FHTTY+PEA SVKPGVPNE Sbjct: 49 YRARILNHDLSCVLCEIVIRSVFHTTYDPEAESVKPGVPNE 89 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 74.1 bits (174), Expect = 1e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +1 Query: 316 NSWKGNPSWYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 + +K YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 156 HDYKAIAMGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 195 >SB_38587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 74.1 bits (174), Expect = 1e-13 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +1 Query: 325 KGNPSWYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 K + + YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 118 KRDGNGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 154 >SB_35762| Best HMM Match : Beta-lactamase (HMM E-Value=7.2e-05) Length = 166 Score = 74.1 bits (174), Expect = 1e-13 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +1 Query: 328 GNPSWYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 G+ YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 131 GDHVGYRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 166 >SB_42207| Best HMM Match : Ank (HMM E-Value=6.3) Length = 71 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 41 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 71 >SB_41480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 75 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 105 >SB_38636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 46 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 76 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 210 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 240 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 113 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 143 >SB_33616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 57 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 87 >SB_31742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 42 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 72 >SB_30562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 66 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 96 >SB_26344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 76 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 106 >SB_11590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 71 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 101 >SB_9170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 43 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 73 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 107 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 137 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 129 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 159 >SB_1641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 58 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 88 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 125 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 155 >SB_59544| Best HMM Match : Secretin_N_2 (HMM E-Value=7.9) Length = 158 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 128 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 158 >SB_56976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 72 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 102 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 170 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 200 >SB_55903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 59 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 89 >SB_55293| Best HMM Match : Hemopexin (HMM E-Value=6.7) Length = 64 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 34 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 64 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 218 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 248 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 161 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 191 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 137 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 167 >SB_41348| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 11 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 41 >SB_38671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 37 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 67 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 134 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 164 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 100 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 130 >SB_36182| Best HMM Match : Fic (HMM E-Value=2.3e-19) Length = 181 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 151 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 181 >SB_34299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 58 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 88 >SB_34022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 99 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 129 >SB_33552| Best HMM Match : MIF (HMM E-Value=9.7) Length = 148 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 118 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 148 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 122 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 152 >SB_24533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 31 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 61 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 110 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 140 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 127 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 157 >SB_17826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 69 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 99 >SB_16932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 36 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 66 >SB_16803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 17 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 47 >SB_14402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 26 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 56 >SB_13755| Best HMM Match : Cyto_ox_2 (HMM E-Value=5.5e-09) Length = 194 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 164 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 194 >SB_13220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 52 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 82 >SB_10480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 30 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 60 >SB_10241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 125 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 155 >SB_9002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 42 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 72 >SB_6812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 155 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 185 >SB_5020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 687 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 657 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 687 >SB_3366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 343 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 435 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA Sbjct: 81 YRARIRNHGHSCFLCEIVIRSQFHTTYEPEA 111 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 72.5 bits (170), Expect = 3e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +2 Query: 341 GTELEFVIMVIAVSCVKLLSAHNSTQHTSRKHKV 442 GTELEFVIMVIAVSCVKLLSAHNSTQHTSRKHKV Sbjct: 152 GTELEFVIMVIAVSCVKLLSAHNSTQHTSRKHKV 185 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 70.9 bits (166), Expect = 9e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 716 LTCSFLRYPLILWITVLPPLSELIPLAAAERP 621 LTCSFLRYPLILWITVLPPLSELIPLAAAERP Sbjct: 783 LTCSFLRYPLILWITVLPPLSELIPLAAAERP 814 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 70.9 bits (166), Expect = 9e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 716 LTCSFLRYPLILWITVLPPLSELIPLAAAERP 621 LTCSFLRYPLILWITVLPPLSELIPLAAAERP Sbjct: 25 LTCSFLRYPLILWITVLPPLSELIPLAAAERP 56 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 70.9 bits (166), Expect = 9e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 716 LTCSFLRYPLILWITVLPPLSELIPLAAAERP 621 LTCSFLRYPLILWITVLPPLSELIPLAAAERP Sbjct: 48 LTCSFLRYPLILWITVLPPLSELIPLAAAERP 79 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 70.9 bits (166), Expect = 9e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 716 LTCSFLRYPLILWITVLPPLSELIPLAAAERP 621 LTCSFLRYPLILWITVLPPLSELIPLAAAERP Sbjct: 430 LTCSFLRYPLILWITVLPPLSELIPLAAAERP 461 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 70.9 bits (166), Expect = 9e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 716 LTCSFLRYPLILWITVLPPLSELIPLAAAERP 621 LTCSFLRYPLILWITVLPPLSELIPLAAAERP Sbjct: 579 LTCSFLRYPLILWITVLPPLSELIPLAAAERP 610 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 70.9 bits (166), Expect = 9e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 716 LTCSFLRYPLILWITVLPPLSELIPLAAAERP 621 LTCSFLRYPLILWITVLPPLSELIPLAAAERP Sbjct: 47 LTCSFLRYPLILWITVLPPLSELIPLAAAERP 78 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 70.9 bits (166), Expect = 9e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 716 LTCSFLRYPLILWITVLPPLSELIPLAAAERP 621 LTCSFLRYPLILWITVLPPLSELIPLAAAERP Sbjct: 25 LTCSFLRYPLILWITVLPPLSELIPLAAAERP 56 >SB_37138| Best HMM Match : RnaseA (HMM E-Value=8) Length = 217 Score = 62.1 bits (144), Expect = 4e-10 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 490 CAHCPLSVGKPVVPAALMNRPTRGERRFAYW 582 C C +VGKPVVPAALMNRPTRGERRFAYW Sbjct: 156 CVFCRNNVGKPVVPAALMNRPTRGERRFAYW 186 >SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 60.9 bits (141), Expect = 1e-09 Identities = 28/35 (80%), Positives = 30/35 (85%), Gaps = 2/35 (5%) Frame = +1 Query: 484 LRCA--HCPLSVGKPVVPAALMNRPTRGERRFAYW 582 LRC+ H L +GKPVVPAALMNRPTRGERRFAYW Sbjct: 92 LRCSRFHQRLKLGKPVVPAALMNRPTRGERRFAYW 126 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 162 ICDTGYIPLPRSLTRYARSFDCGERKWLT 190 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 60.5 bits (140), Expect = 1e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 487 RCAHCPLSVGKPVVPAALMNRPTRGERRFAYW 582 RC +VGKPVVPAALMNRPTRGERRFAYW Sbjct: 67 RCRRYMATVGKPVVPAALMNRPTRGERRFAYW 98 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWLT 162 >SB_56823| Best HMM Match : Rhabdo_NV (HMM E-Value=7.4) Length = 157 Score = 60.1 bits (139), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 359 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 442 VIMVIAVSCVKLLSAHNSTQHTSRKHKV Sbjct: 130 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 157 >SB_54715| Best HMM Match : Hexapep (HMM E-Value=1.2e-05) Length = 1143 Score = 60.1 bits (139), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 359 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 442 VIMVIAVSCVKLLSAHNSTQHTSRKHKV Sbjct: 1116 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 1143 >SB_50679| Best HMM Match : Tombus_P19 (HMM E-Value=2.1) Length = 330 Score = 60.1 bits (139), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 359 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 442 VIMVIAVSCVKLLSAHNSTQHTSRKHKV Sbjct: 303 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 330 >SB_35269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 60.1 bits (139), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 359 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 442 VIMVIAVSCVKLLSAHNSTQHTSRKHKV Sbjct: 145 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 172 >SB_33473| Best HMM Match : GST_N (HMM E-Value=0.028) Length = 276 Score = 60.1 bits (139), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 359 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 442 VIMVIAVSCVKLLSAHNSTQHTSRKHKV Sbjct: 249 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 276 >SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) Length = 224 Score = 60.1 bits (139), Expect = 2e-09 Identities = 29/46 (63%), Positives = 32/46 (69%) Frame = +1 Query: 445 KPGVPNE*ANSH*LRCAHCPLSVGKPVVPAALMNRPTRGERRFAYW 582 +PG + A + A SVGKPVVPAALMNRPTRGERRFAYW Sbjct: 88 RPGSGSNLAPAQDDHSAFAEFSVGKPVVPAALMNRPTRGERRFAYW 133 >SB_8585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 60.1 bits (139), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 359 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 442 VIMVIAVSCVKLLSAHNSTQHTSRKHKV Sbjct: 211 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 238 >SB_4893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 60.1 bits (139), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 359 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 442 VIMVIAVSCVKLLSAHNSTQHTSRKHKV Sbjct: 255 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 282 >SB_3631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 60.1 bits (139), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 359 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 442 VIMVIAVSCVKLLSAHNSTQHTSRKHKV Sbjct: 229 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 256 >SB_40844| Best HMM Match : DUF595 (HMM E-Value=6.1) Length = 194 Score = 60.1 bits (139), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 359 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 442 VIMVIAVSCVKLLSAHNSTQHTSRKHKV Sbjct: 167 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 194 >SB_38057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 60.1 bits (139), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 359 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 442 VIMVIAVSCVKLLSAHNSTQHTSRKHKV Sbjct: 176 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 203 >SB_26734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 60.1 bits (139), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 359 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 442 VIMVIAVSCVKLLSAHNSTQHTSRKHKV Sbjct: 123 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 150 >SB_7597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 60.1 bits (139), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 359 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 442 VIMVIAVSCVKLLSAHNSTQHTSRKHKV Sbjct: 181 VIMVIAVSCVKLLSAHNSTQHTSRKHKV 208 >SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2) Length = 300 Score = 59.7 bits (138), Expect = 2e-09 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +1 Query: 490 CAHCPLSVGKPVVPAALMNRPTRGERRFAYW 582 C L VGKPVVPAALMNRPTRGERRFAYW Sbjct: 189 CCTTLLQVGKPVVPAALMNRPTRGERRFAYW 219 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 255 ICDTGYIPLPRSLTRYARSFDCGERKWLT 283 >SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) Length = 490 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 502 PLSVGKPVVPAALMNRPTRGERRFAYW 582 P VGKPVVPAALMNRPTRGERRFAYW Sbjct: 347 PTGVGKPVVPAALMNRPTRGERRFAYW 373 >SB_13637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +1 Query: 505 LSVGKPVVPAALMNRPTRGERRFAYW 582 +SVGKPVVPAALMNRPTRGERRFAYW Sbjct: 28 ISVGKPVVPAALMNRPTRGERRFAYW 53 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 89 ICDTGYIPLPRSLTRYARSFDCGERKWLT 117 >SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) Length = 110 Score = 58.8 bits (136), Expect = 4e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +1 Query: 505 LSVGKPVVPAALMNRPTRGERRFAYW 582 L+VGKPVVPAALMNRPTRGERRFAYW Sbjct: 54 LAVGKPVVPAALMNRPTRGERRFAYW 79 >SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 58.8 bits (136), Expect = 4e-09 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 502 PLSVGKPVVPAALMNRPTRGERRFAYW 582 P +VGKPVVPAALMNRPTRGERRFAYW Sbjct: 13 PNAVGKPVVPAALMNRPTRGERRFAYW 39 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 75 ICDTGYIPLPRSLTRYARSFDCGERKWLT 103 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 58.8 bits (136), Expect = 4e-09 Identities = 32/54 (59%), Positives = 35/54 (64%), Gaps = 2/54 (3%) Frame = +1 Query: 427 PEA*SVKPGVPNE*ANSH*LRCAHCPLS--VGKPVVPAALMNRPTRGERRFAYW 582 P S +P P +S + PLS VGKPVVPAALMNRPTRGERRFAYW Sbjct: 263 PRVASRRPPPPLPPPDSSEAQAQQPPLSPPVGKPVVPAALMNRPTRGERRFAYW 316 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 352 ICDTGYIPLPRSLTRYARSFDCGERKWLT 380 >SB_8316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 58.8 bits (136), Expect = 4e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +1 Query: 505 LSVGKPVVPAALMNRPTRGERRFAYW 582 L+VGKPVVPAALMNRPTRGERRFAYW Sbjct: 17 LAVGKPVVPAALMNRPTRGERRFAYW 42 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 78 ICDTGYIPLPRSLTRYARSFDCGERKWLT 106 >SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 58.4 bits (135), Expect = 5e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 508 SVGKPVVPAALMNRPTRGERRFAYW 582 SVGKPVVPAALMNRPTRGERRFAYW Sbjct: 46 SVGKPVVPAALMNRPTRGERRFAYW 70 >SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) Length = 155 Score = 58.4 bits (135), Expect = 5e-09 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = +1 Query: 475 SH*LRCAHCPLSVGKPVVPAALMNRPTRGERRFAYW 582 SH C C S GKPVVPAALMNRPTRGERRFAYW Sbjct: 41 SHDPICTTC--SFGKPVVPAALMNRPTRGERRFAYW 74 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 110 ICDTGYIPLPRSLTRYARSFDCGERKWLT 138 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 58.4 bits (135), Expect = 5e-09 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 502 PLSVGKPVVPAALMNRPTRGERRFAYW 582 P VGKPVVPAALMNRPTRGERRFAYW Sbjct: 461 PEQVGKPVVPAALMNRPTRGERRFAYW 487 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 523 ICDTGYIPLPRSLTRYARSFDCGERKWLT 551 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 58.4 bits (135), Expect = 5e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 508 SVGKPVVPAALMNRPTRGERRFAYW 582 SVGKPVVPAALMNRPTRGERRFAYW Sbjct: 461 SVGKPVVPAALMNRPTRGERRFAYW 485 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 521 ICDTGYIPLPRSLTRYARSFDCGERKWLT 549 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 58.4 bits (135), Expect = 5e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 508 SVGKPVVPAALMNRPTRGERRFAYW 582 SVGKPVVPAALMNRPTRGERRFAYW Sbjct: 39 SVGKPVVPAALMNRPTRGERRFAYW 63 >SB_44687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 58.4 bits (135), Expect = 5e-09 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +1 Query: 505 LSVGKPVVPAALMNRPTRGERRFAYW 582 L VGKPVVPAALMNRPTRGERRFAYW Sbjct: 73 LGVGKPVVPAALMNRPTRGERRFAYW 98 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 58.0 bits (134), Expect = 7e-09 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +1 Query: 505 LSVGKPVVPAALMNRPTRGERRFAYW 582 L VGKPVVPAALMNRPTRGERRFAYW Sbjct: 306 LPVGKPVVPAALMNRPTRGERRFAYW 331 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 367 ICDTGYIPLPRSLTRYARSFDCGERKWLT 395 >SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) Length = 141 Score = 58.0 bits (134), Expect = 7e-09 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +1 Query: 505 LSVGKPVVPAALMNRPTRGERRFAYW 582 L VGKPVVPAALMNRPTRGERRFAYW Sbjct: 85 LRVGKPVVPAALMNRPTRGERRFAYW 110 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 58.0 bits (134), Expect = 7e-09 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 508 SVGKPVVPAALMNRPTRGERRFAYW 582 S+GKPVVPAALMNRPTRGERRFAYW Sbjct: 177 SIGKPVVPAALMNRPTRGERRFAYW 201 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 237 ICDTGYIPLPRSLTRYARSFDCGERKWLT 265 >SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) Length = 198 Score = 58.0 bits (134), Expect = 7e-09 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 505 LSVGKPVVPAALMNRPTRGERRFAYW 582 ++VGKPVVPAALMNRPTRGERRFAYW Sbjct: 92 MAVGKPVVPAALMNRPTRGERRFAYW 117 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGERKWLT 181 >SB_10448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 58.0 bits (134), Expect = 7e-09 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 508 SVGKPVVPAALMNRPTRGERRFAYW 582 S+GKPVVPAALMNRPTRGERRFAYW Sbjct: 69 SIGKPVVPAALMNRPTRGERRFAYW 93 >SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) Length = 521 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 1/30 (3%) Frame = +1 Query: 496 HCPLSV-GKPVVPAALMNRPTRGERRFAYW 582 +C +SV GKPVVPAALMNRPTRGERRFAYW Sbjct: 375 YCIISVLGKPVVPAALMNRPTRGERRFAYW 404 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 440 ICDTGYIPLPRSLTRYARSFDCGERKWLT 468 >SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) Length = 286 Score = 58.0 bits (134), Expect = 7e-09 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 502 PLSVGKPVVPAALMNRPTRGERRFAYW 582 P VGKPVVPAALMNRPTRGERRFAYW Sbjct: 179 PPPVGKPVVPAALMNRPTRGERRFAYW 205 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 241 ICDTGYIPLPRSLTRYARSFDCGERKWLT 269 >SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) Length = 167 Score = 58.0 bits (134), Expect = 7e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 499 CPLSVGKPVVPAALMNRPTRGERRFAYW 582 C VGKPVVPAALMNRPTRGERRFAYW Sbjct: 59 CRKVVGKPVVPAALMNRPTRGERRFAYW 86 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWLT 150 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 57.6 bits (133), Expect = 9e-09 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 505 LSVGKPVVPAALMNRPTRGERRFAYW 582 L +GKPVVPAALMNRPTRGERRFAYW Sbjct: 178 LPIGKPVVPAALMNRPTRGERRFAYW 203 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 239 ICDTGYIPLPRSLTRYARSFDCGERKWLT 267 >SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 57.6 bits (133), Expect = 9e-09 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 505 LSVGKPVVPAALMNRPTRGERRFAYW 582 +S+GKPVVPAALMNRPTRGERRFAYW Sbjct: 136 VSLGKPVVPAALMNRPTRGERRFAYW 161 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 57.6 bits (133), Expect = 9e-09 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 505 LSVGKPVVPAALMNRPTRGERRFAYW 582 ++VGKPVVPAALMNRPTRGERRFAYW Sbjct: 61 VTVGKPVVPAALMNRPTRGERRFAYW 86 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWLT 150 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 57.6 bits (133), Expect = 9e-09 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 505 LSVGKPVVPAALMNRPTRGERRFAYW 582 + VGKPVVPAALMNRPTRGERRFAYW Sbjct: 166 IQVGKPVVPAALMNRPTRGERRFAYW 191 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 227 ICDTGYIPLPRSLTRYARSFDCGERKWLT 255 >SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 57.6 bits (133), Expect = 9e-09 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 505 LSVGKPVVPAALMNRPTRGERRFAYW 582 L +GKPVVPAALMNRPTRGERRFAYW Sbjct: 30 LRIGKPVVPAALMNRPTRGERRFAYW 55 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 91 ICDTGYIPLPRSLTRYARSFDCGERKWLT 119 >SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) Length = 678 Score = 57.6 bits (133), Expect = 9e-09 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 505 LSVGKPVVPAALMNRPTRGERRFAYW 582 + VGKPVVPAALMNRPTRGERRFAYW Sbjct: 135 IQVGKPVVPAALMNRPTRGERRFAYW 160 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 196 ICDTGYIPLPRSLTRYARSFDCGERKWLT 224 >SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) Length = 147 Score = 57.6 bits (133), Expect = 9e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 490 CAHCPLSVGKPVVPAALMNRPTRGERRFAYW 582 C+ P +VGKPVVPAALMNRPTRGERRFAYW Sbjct: 37 CSGQP-NVGKPVVPAALMNRPTRGERRFAYW 66 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGERKWLT 130 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 508 SVGKPVVPAALMNRPTRGERRFAYW 582 +VGKPVVPAALMNRPTRGERRFAYW Sbjct: 37 NVGKPVVPAALMNRPTRGERRFAYW 61 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 >SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) Length = 255 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 508 SVGKPVVPAALMNRPTRGERRFAYW 582 +VGKPVVPAALMNRPTRGERRFAYW Sbjct: 150 AVGKPVVPAALMNRPTRGERRFAYW 174 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 210 ICDTGYIPLPRSLTRYARSFDCGERKWLT 238 >SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) Length = 339 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 505 LSVGKPVVPAALMNRPTRGERRFAYW 582 + VGKPVVPAALMNRPTRGERRFAYW Sbjct: 179 IRVGKPVVPAALMNRPTRGERRFAYW 204 >SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) Length = 149 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 508 SVGKPVVPAALMNRPTRGERRFAYW 582 +VGKPVVPAALMNRPTRGERRFAYW Sbjct: 44 TVGKPVVPAALMNRPTRGERRFAYW 68 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 104 ICDTGYIPLPRSLTRYARSFDCGERKWLT 132 >SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) Length = 230 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 508 SVGKPVVPAALMNRPTRGERRFAYW 582 +VGKPVVPAALMNRPTRGERRFAYW Sbjct: 175 AVGKPVVPAALMNRPTRGERRFAYW 199 >SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 505 LSVGKPVVPAALMNRPTRGERRFAYW 582 + VGKPVVPAALMNRPTRGERRFAYW Sbjct: 61 VKVGKPVVPAALMNRPTRGERRFAYW 86 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWLT 150 >SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2102 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 508 SVGKPVVPAALMNRPTRGERRFAYW 582 +VGKPVVPAALMNRPTRGERRFAYW Sbjct: 478 AVGKPVVPAALMNRPTRGERRFAYW 502 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 538 ICDTGYIPLPRSLTRYARSFDCGERKWLT 566 >SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) Length = 157 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 508 SVGKPVVPAALMNRPTRGERRFAYW 582 +VGKPVVPAALMNRPTRGERRFAYW Sbjct: 52 AVGKPVVPAALMNRPTRGERRFAYW 76 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 112 ICDTGYIPLPRSLTRYARSFDCGERKWLT 140 >SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) Length = 1427 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 484 LRCAHCPLSVGKPVVPAALMNRPTRGERRFAYW 582 LR + L GKPVVPAALMNRPTRGERRFAYW Sbjct: 1314 LRRKNIYLKFGKPVVPAALMNRPTRGERRFAYW 1346 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 1382 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1410 >SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/31 (80%), Positives = 25/31 (80%) Frame = +1 Query: 490 CAHCPLSVGKPVVPAALMNRPTRGERRFAYW 582 C VGKPVVPAALMNRPTRGERRFAYW Sbjct: 38 CCKAIKLVGKPVVPAALMNRPTRGERRFAYW 68 >SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) Length = 171 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 505 LSVGKPVVPAALMNRPTRGERRFAYW 582 + VGKPVVPAALMNRPTRGERRFAYW Sbjct: 65 VGVGKPVVPAALMNRPTRGERRFAYW 90 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 126 ICDTGYIPLPRSLTRYARSFDCGERKWLT 154 >SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) Length = 369 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 508 SVGKPVVPAALMNRPTRGERRFAYW 582 +VGKPVVPAALMNRPTRGERRFAYW Sbjct: 264 AVGKPVVPAALMNRPTRGERRFAYW 288 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 324 ICDTGYIPLPRSLTRYARSFDCGERKWLT 352 >SB_18550| Best HMM Match : DUF987 (HMM E-Value=4.4) Length = 159 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 508 SVGKPVVPAALMNRPTRGERRFAYW 582 +VGKPVVPAALMNRPTRGERRFAYW Sbjct: 49 AVGKPVVPAALMNRPTRGERRFAYW 73 >SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) Length = 841 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 508 SVGKPVVPAALMNRPTRGERRFAYW 582 +VGKPVVPAALMNRPTRGERRFAYW Sbjct: 736 TVGKPVVPAALMNRPTRGERRFAYW 760 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 796 ICDTGYIPLPRSLTRYARSFDCGERKWLT 824 >SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) Length = 556 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/31 (80%), Positives = 25/31 (80%) Frame = +1 Query: 490 CAHCPLSVGKPVVPAALMNRPTRGERRFAYW 582 C VGKPVVPAALMNRPTRGERRFAYW Sbjct: 287 CCKAIKLVGKPVVPAALMNRPTRGERRFAYW 317 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 353 ICDTGYIPLPRSLTRYARSFDCGERKWLT 381 >SB_5006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 657 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 508 SVGKPVVPAALMNRPTRGERRFAYW 582 +VGKPVVPAALMNRPTRGERRFAYW Sbjct: 350 AVGKPVVPAALMNRPTRGERRFAYW 374 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 410 ICDTGYIPLPRSLTRYARSFDCGERKWLT 438 >SB_864| Best HMM Match : Sulfotransfer_1 (HMM E-Value=6.4e-05) Length = 524 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 508 SVGKPVVPAALMNRPTRGERRFAYW 582 S+GKPVVPAALMNRPTRGERRFAYW Sbjct: 298 SLGKPVVPAALMNRPTRGERRFAYW 322 >SB_857| Best HMM Match : Mago_nashi (HMM E-Value=0) Length = 900 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 508 SVGKPVVPAALMNRPTRGERRFAYW 582 +VGKPVVPAALMNRPTRGERRFAYW Sbjct: 845 TVGKPVVPAALMNRPTRGERRFAYW 869 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 18 VGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 461 MSELTHINCVALTARFQSG 517 MSELTHINCVALTARF G Sbjct: 1 MSELTHINCVALTARFPVG 19 >SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 66 VGKPVVPAALMNRPTRGERRFAYW 89 >SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) Length = 168 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 114 VGKPVVPAALMNRPTRGERRFAYW 137 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 113 VGKPVVPAALMNRPTRGERRFAYW 136 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 172 ICDTGYIPLPRSLTRYARSFDCGERKWLT 200 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 18 VGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 461 MSELTHINCVALTARFQSG 517 MSELTHINCVALTARF G Sbjct: 1 MSELTHINCVALTARFPVG 19 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 38 VGKPVVPAALMNRPTRGERRFAYW 61 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 >SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 135 VGKPVVPAALMNRPTRGERRFAYW 158 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 237 VGKPVVPAALMNRPTRGERRFAYW 260 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 296 ICDTGYIPLPRSLTRYARSFDCGERKWLT 324 >SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 57 VGKPVVPAALMNRPTRGERRFAYW 80 >SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 75 VGKPVVPAALMNRPTRGERRFAYW 98 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWLT 162 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 62 VGKPVVPAALMNRPTRGERRFAYW 85 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGERKWLT 149 >SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) Length = 187 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 133 VGKPVVPAALMNRPTRGERRFAYW 156 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 87 VGKPVVPAALMNRPTRGERRFAYW 110 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 146 ICDTGYIPLPRSLTRYARSFDCGERKWLT 174 >SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 51 VGKPVVPAALMNRPTRGERRFAYW 74 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 18 VGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 461 MSELTHINCVALTARFQSG 517 MSELTHINCVALTARF G Sbjct: 1 MSELTHINCVALTARFPVG 19 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 147 VGKPVVPAALMNRPTRGERRFAYW 170 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 44 VGKPVVPAALMNRPTRGERRFAYW 67 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 103 ICDTGYIPLPRSLTRYARSFDCGERKWLT 131 >SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 45 VGKPVVPAALMNRPTRGERRFAYW 68 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 34 VGKPVVPAALMNRPTRGERRFAYW 57 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 >SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 33 VGKPVVPAALMNRPTRGERRFAYW 56 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWLT 120 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 334 VGKPVVPAALMNRPTRGERRFAYW 357 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 393 ICDTGYIPLPRSLTRYARSFDCGERKWLT 421 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 18 VGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 461 MSELTHINCVALTARFQSG 517 MSELTHINCVALTARF G Sbjct: 1 MSELTHINCVALTARFPVG 19 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 89 VGKPVVPAALMNRPTRGERRFAYW 112 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 148 ICDTGYIPLPRSLTRYARSFDCGERKWLT 176 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 75 VGKPVVPAALMNRPTRGERRFAYW 98 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWLT 162 >SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 552 VGKPVVPAALMNRPTRGERRFAYW 575 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 611 ICDTGYIPLPRSLTRYARSFDCGERKWLT 639 >SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 264 VGKPVVPAALMNRPTRGERRFAYW 287 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 18 VGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 461 MSELTHINCVALTARFQSG 517 MSELTHINCVALTARF G Sbjct: 1 MSELTHINCVALTARFPVG 19 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 109 VGKPVVPAALMNRPTRGERRFAYW 132 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 168 ICDTGYIPLPRSLTRYARSFDCGERKWLT 196 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 505 LSVGKPVVPAALMNRPTRGERRFAYW 582 +S GKPVVPAALMNRPTRGERRFAYW Sbjct: 71 VSFGKPVVPAALMNRPTRGERRFAYW 96 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWLT 160 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 35 VGKPVVPAALMNRPTRGERRFAYW 58 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGERKWLT 122 >SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) Length = 99 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 505 LSVGKPVVPAALMNRPTRGERRFAYW 582 +S GKPVVPAALMNRPTRGERRFAYW Sbjct: 43 VSFGKPVVPAALMNRPTRGERRFAYW 68 >SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 469 VGKPVVPAALMNRPTRGERRFAYW 492 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 66 VGKPVVPAALMNRPTRGERRFAYW 89 >SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 29 VGKPVVPAALMNRPTRGERRFAYW 52 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 120 VGKPVVPAALMNRPTRGERRFAYW 143 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 179 ICDTGYIPLPRSLTRYARSFDCGERKWLT 207 >SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 43 VGKPVVPAALMNRPTRGERRFAYW 66 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGERKWLT 130 >SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 57 VGKPVVPAALMNRPTRGERRFAYW 80 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 78 VGKPVVPAALMNRPTRGERRFAYW 101 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 137 ICDTGYIPLPRSLTRYARSFDCGERKWLT 165 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 18 VGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 461 MSELTHINCVALTARFQSG 517 MSELTHINCVALTARF G Sbjct: 1 MSELTHINCVALTARFPVG 19 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 94 VGKPVVPAALMNRPTRGERRFAYW 117 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGERKWLT 181 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 18 VGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 461 MSELTHINCVALTARFQSG 517 MSELTHINCVALTARF G Sbjct: 1 MSELTHINCVALTARFPVG 19 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 18 VGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 461 MSELTHINCVALTARFQSG 517 MSELTHINCVALTARF G Sbjct: 1 MSELTHINCVALTARFPVG 19 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 18 VGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 461 MSELTHINCVALTARFQSG 517 MSELTHINCVALTARF G Sbjct: 1 MSELTHINCVALTARFPVG 19 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 54 VGKPVVPAALMNRPTRGERRFAYW 77 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 >SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 40 VGKPVVPAALMNRPTRGERRFAYW 63 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 155 VGKPVVPAALMNRPTRGERRFAYW 178 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 54 VGKPVVPAALMNRPTRGERRFAYW 77 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 >SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) Length = 711 Score = 56.8 bits (131), Expect = 2e-08 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 505 LSVGKPVVPAALMNRPTRGERRFAYW 582 + +GKPVVPAALMNRPTRGERRFAYW Sbjct: 639 VQIGKPVVPAALMNRPTRGERRFAYW 664 >SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) Length = 216 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 112 VGKPVVPAALMNRPTRGERRFAYW 135 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGERKWLT 199 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 38 VGKPVVPAALMNRPTRGERRFAYW 61 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 >SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) Length = 216 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 162 VGKPVVPAALMNRPTRGERRFAYW 185 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 37 VGKPVVPAALMNRPTRGERRFAYW 60 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 96 ICDTGYIPLPRSLTRYARSFDCGERKWLT 124 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 18 VGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 461 MSELTHINCVALTARFQSG 517 MSELTHINCVALTARF G Sbjct: 1 MSELTHINCVALTARFPVG 19 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 58 VGKPVVPAALMNRPTRGERRFAYW 81 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 117 ICDTGYIPLPRSLTRYARSFDCGERKWLT 145 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 80 VGKPVVPAALMNRPTRGERRFAYW 103 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 139 ICDTGYIPLPRSLTRYARSFDCGERKWLT 167 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 57 VGKPVVPAALMNRPTRGERRFAYW 80 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 116 ICDTGYIPLPRSLTRYARSFDCGERKWLT 144 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 18 VGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 >SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 57 VGKPVVPAALMNRPTRGERRFAYW 80 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 40 VGKPVVPAALMNRPTRGERRFAYW 63 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 99 ICDTGYIPLPRSLTRYARSFDCGERKWLT 127 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 505 LSVGKPVVPAALMNRPTRGERRFAYW 582 +S GKPVVPAALMNRPTRGERRFAYW Sbjct: 567 VSFGKPVVPAALMNRPTRGERRFAYW 592 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 628 ICDTGYIPLPRSLTRYARSFDCGERKWLT 656 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 291 VGKPVVPAALMNRPTRGERRFAYW 314 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 350 ICDTGYIPLPRSLTRYARSFDCGERKWLT 378 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 38 VGKPVVPAALMNRPTRGERRFAYW 61 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 505 LSVGKPVVPAALMNRPTRGERRFAYW 582 +S GKPVVPAALMNRPTRGERRFAYW Sbjct: 62 VSFGKPVVPAALMNRPTRGERRFAYW 87 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGERKWLT 151 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 505 LSVGKPVVPAALMNRPTRGERRFAYW 582 +S GKPVVPAALMNRPTRGERRFAYW Sbjct: 793 VSFGKPVVPAALMNRPTRGERRFAYW 818 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 854 ICDTGYIPLPRSLTRYARSFDCGERKWLT 882 >SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) Length = 917 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 574 VGKPVVPAALMNRPTRGERRFAYW 597 >SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) Length = 709 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 130 VGKPVVPAALMNRPTRGERRFAYW 153 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 79 VGKPVVPAALMNRPTRGERRFAYW 102 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 138 ICDTGYIPLPRSLTRYARSFDCGERKWLT 166 >SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 209 VGKPVVPAALMNRPTRGERRFAYW 232 >SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 480 VGKPVVPAALMNRPTRGERRFAYW 503 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 539 ICDTGYIPLPRSLTRYARSFDCGERKWLT 567 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 18 VGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 461 MSELTHINCVALTARFQSG 517 MSELTHINCVALTARF G Sbjct: 1 MSELTHINCVALTARFPVG 19 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 25 VGKPVVPAALMNRPTRGERRFAYW 48 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 84 ICDTGYIPLPRSLTRYARSFDCGERKWLT 112 >SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 733 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 18 VGKPVVPAALMNRPTRGERRFAYW 41 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 461 MSELTHINCVALTARFQSG 517 MSELTHINCVALTARF G Sbjct: 1 MSELTHINCVALTARFPVG 19 >SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) Length = 189 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 135 VGKPVVPAALMNRPTRGERRFAYW 158 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 93 VGKPVVPAALMNRPTRGERRFAYW 116 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWLT 180 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 56.8 bits (131), Expect = 2e-08 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +1 Query: 508 SVGKPVVPAALMNRPTRGERRFAYW 582 ++GKPVVPAALMNRPTRGERRFAYW Sbjct: 429 TIGKPVVPAALMNRPTRGERRFAYW 453 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 489 ICDTGYIPLPRSLTRYARSFDCGERKWLT 517 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 18 VGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 461 MSELTHINCVALTARFQSG 517 MSELTHINCVALTARF G Sbjct: 1 MSELTHINCVALTARFPVG 19 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 34 VGKPVVPAALMNRPTRGERRFAYW 57 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 >SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 37 VGKPVVPAALMNRPTRGERRFAYW 60 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 226 VGKPVVPAALMNRPTRGERRFAYW 249 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 285 ICDTGYIPLPRSLTRYARSFDCGERKWLT 313 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 233 VGKPVVPAALMNRPTRGERRFAYW 256 >SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) Length = 247 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 193 VGKPVVPAALMNRPTRGERRFAYW 216 >SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) Length = 190 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 136 VGKPVVPAALMNRPTRGERRFAYW 159 >SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 29 VGKPVVPAALMNRPTRGERRFAYW 52 >SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 33 VGKPVVPAALMNRPTRGERRFAYW 56 >SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) Length = 911 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 745 VGKPVVPAALMNRPTRGERRFAYW 768 >SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 92 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 38 VGKPVVPAALMNRPTRGERRFAYW 61 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 18 VGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 461 MSELTHINCVALTARFQSG 517 MSELTHINCVALTARF G Sbjct: 1 MSELTHINCVALTARFPVG 19 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 18 VGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 461 MSELTHINCVALTARFQSG 517 MSELTHINCVALTARF G Sbjct: 1 MSELTHINCVALTARFPVG 19 >SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 15 VGKPVVPAALMNRPTRGERRFAYW 38 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLT 102 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 135 VGKPVVPAALMNRPTRGERRFAYW 158 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 194 ICDTGYIPLPRSLTRYARSFDCGERKWLT 222 >SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 96 VGKPVVPAALMNRPTRGERRFAYW 119 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 220 VGKPVVPAALMNRPTRGERRFAYW 243 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 279 ICDTGYIPLPRSLTRYARSFDCGERKWLT 307 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 46 VGKPVVPAALMNRPTRGERRFAYW 69 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGERKWLT 133 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 54 VGKPVVPAALMNRPTRGERRFAYW 77 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 >SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) Length = 225 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 171 VGKPVVPAALMNRPTRGERRFAYW 194 >SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) Length = 1652 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 18 VGKPVVPAALMNRPTRGERRFAYW 41 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 461 MSELTHINCVALTARFQSG 517 MSELTHINCVALTARF G Sbjct: 1 MSELTHINCVALTARFPVG 19 >SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) Length = 1728 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 1674 VGKPVVPAALMNRPTRGERRFAYW 1697 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 96 VGKPVVPAALMNRPTRGERRFAYW 119 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 155 ICDTGYIPLPRSLTRYARSFDCGERKWLT 183 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 64 VGKPVVPAALMNRPTRGERRFAYW 87 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGERKWLT 151 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 18 VGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 461 MSELTHINCVALTARFQSG 517 MSELTHINCVALTARF G Sbjct: 1 MSELTHINCVALTARFPVG 19 >SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) Length = 409 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 108 VGKPVVPAALMNRPTRGERRFAYW 131 >SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 94 VGKPVVPAALMNRPTRGERRFAYW 117 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 18 VGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 461 MSELTHINCVALTARFQSG 517 MSELTHINCVALTARF G Sbjct: 1 MSELTHINCVALTARFPVG 19 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 33 VGKPVVPAALMNRPTRGERRFAYW 56 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWLT 120 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 42 VGKPVVPAALMNRPTRGERRFAYW 65 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 936 VGKPVVPAALMNRPTRGERRFAYW 959 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 995 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1023 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 83 VGKPVVPAALMNRPTRGERRFAYW 106 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 142 ICDTGYIPLPRSLTRYARSFDCGERKWLT 170 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 416 VGKPVVPAALMNRPTRGERRFAYW 439 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 475 ICDTGYIPLPRSLTRYARSFDCGERKWLT 503 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 98 VGKPVVPAALMNRPTRGERRFAYW 121 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 157 ICDTGYIPLPRSLTRYARSFDCGERKWLT 185 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 71 VGKPVVPAALMNRPTRGERRFAYW 94 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWLT 158 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 84 VGKPVVPAALMNRPTRGERRFAYW 107 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 143 ICDTGYIPLPRSLTRYARSFDCGERKWLT 171 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 42 VGKPVVPAALMNRPTRGERRFAYW 65 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 42 VGKPVVPAALMNRPTRGERRFAYW 65 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 86 VGKPVVPAALMNRPTRGERRFAYW 109 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 145 ICDTGYIPLPRSLTRYARSFDCGERKWLT 173 >SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) Length = 197 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 511 VGKPVVPAALMNRPTRGERRFAYW 582 VGKPVVPAALMNRPTRGERRFAYW Sbjct: 93 VGKPVVPAALMNRPTRGERRFAYW 116 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 570 VCVLGALPLPRSLTRCARXFGCGERYQLT 656 +C G +PLPRSLTR AR F CGER LT Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWLT 180 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,757,524 Number of Sequences: 59808 Number of extensions: 456188 Number of successful extensions: 2705 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2012 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2705 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -