BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0336 (720 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g50260.1 68414.m05635 C2 domain-containing protein low simila... 30 1.3 At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, put... 30 1.8 At1g76965.1 68414.m08961 glycine-rich protein 29 2.3 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 4.1 At5g42370.1 68418.m05159 expressed protein 29 4.1 At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identic... 29 4.1 At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative... 28 5.4 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 5.4 At5g22740.1 68418.m02656 glycosyl transferase family 2 protein s... 28 7.2 At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 28 7.2 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 28 7.2 At5g60000.1 68418.m07524 hypothetical protein 27 9.5 At5g22390.1 68418.m02612 expressed protein 27 9.5 >At1g50260.1 68414.m05635 C2 domain-containing protein low similarity to CLB1 [Lycopersicon esculentum] GI:2789434; contains Pfam profile PF00168: C2 domain Length = 675 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 583 RTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQN 699 R+RVLRPS + + + +S FR S T R A N Sbjct: 37 RSRVLRPSVKISNFRFISCGFRGNSKNLRLTDSSRKAAN 75 >At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 884 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +2 Query: 566 TFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPFNGQLRT 700 T+ T SG R++L+ R+ D HD + PFNG T Sbjct: 179 TYVTQSGSLMMSF-RVYLSNSDASIRYADDVHDRIWSPFNGSSHT 222 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 2.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 459 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 364 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 4.1 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -1 Query: 246 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 112 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 4.1 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -2 Query: 185 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 75 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identical to low affinity calcium antiporter CAX2 (GI:1488267) [Arabidopsis thaliana]; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 441 Score = 28.7 bits (61), Expect = 4.1 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +3 Query: 48 SIIVPSSLKTSVRRGNPKWPEDAAERSGKSFLFC--LSVRVPWNPI 179 S++ SL TS + PK P+++ S K +FC L++ +P+ P+ Sbjct: 41 SLMEQGSLSTSFPQHTPKAPKNSVLNSIKIVIFCNKLNLLLPFGPL 86 >At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative strong similarity to probable NADP-dependent oxidoreductase (zeta-crystallin homolog) P1 [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430], Arabidopsis thaliana Length = 239 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 590 RVRIQSET*DDFRECHIKYIQFLRPH 513 R+RIQ DF + + K+++FL PH Sbjct: 172 RIRIQGFVVSDFYDEYSKFLEFLHPH 197 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 5.4 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 241 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 143 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At5g22740.1 68418.m02656 glycosyl transferase family 2 protein similar to beta-(1-3)-glucosyl transferase GB:AAC62210 GI:3687658 from [Bradyrhizobium japonicum], cellulose synthase from Agrobacterium tumeficiens [gi:710492] and Agrobacterium radiobacter [gi:710493]; contains Pfam glycosyl transferase, group 2 family protein domain PF00535 Length = 534 Score = 27.9 bits (59), Expect = 7.2 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = +2 Query: 518 ASKTVYI*YDTRENRLTFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPF 682 ASK + I Y RENR+ ++ G+ GL R + V+ C + + D P F Sbjct: 154 ASKGINIRYQIRENRVGYKAGA--LKEGLKRSY--VKHCEYVVIFDADFQPEPDF 204 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 7.2 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -1 Query: 468 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 349 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 7.2 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -1 Query: 468 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 349 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At5g60000.1 68418.m07524 hypothetical protein Length = 149 Score = 27.5 bits (58), Expect = 9.5 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 1/70 (1%) Frame = -2 Query: 335 RGSSPWRPAADMGTNRRDISTYIPHLNFKVRREYPD-TAANAVLFAFRTISPFYRIPWNS 159 +GS PW+P +GT R+ + + + D T + F FYR WN+ Sbjct: 78 QGSRPWQPRTCIGTFYREAHFGMHETPYVLYNSDKDATESKNSCFVVVKDDGFYR--WNN 135 Query: 158 NAQAEKKTLP 129 N + K P Sbjct: 136 NKRIWDKVFP 145 >At5g22390.1 68418.m02612 expressed protein Length = 202 Score = 27.5 bits (58), Expect = 9.5 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 120 ERSGKSFLFCLSVRVPWNPIEG 185 + S KSFL LS PWNP +G Sbjct: 17 DNSPKSFLDTLSSSSPWNPSKG 38 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,035,169 Number of Sequences: 28952 Number of extensions: 383507 Number of successful extensions: 1100 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1055 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1100 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1565336320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -