BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0333 (737 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 39 0.15 UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 38 0.34 UniRef50_Q0SHW7 Cluster: Putative uncharacterized protein; n=1; ... 34 4.2 UniRef50_Q7NGA4 Cluster: Gll3269 protein; n=4; Bacteria|Rep: Gll... 33 7.3 UniRef50_A7B1N8 Cluster: Putative uncharacterized protein; n=1; ... 33 7.3 UniRef50_A5P3C2 Cluster: Putative uncharacterized protein; n=1; ... 33 9.7 UniRef50_A0PYD2 Cluster: Helicase, SNF2/RAD54 family, putative; ... 33 9.7 UniRef50_Q55A22 Cluster: Putative uncharacterized protein; n=3; ... 33 9.7 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 38.7 bits (86), Expect = 0.15 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 620 RWVDELTAHLVLSGYRNP 567 RWVDELTAHLVLSGY +P Sbjct: 158 RWVDELTAHLVLSGYWSP 175 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 37.5 bits (83), Expect = 0.34 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -2 Query: 445 AGWWCLPARTYKRSYHLY 392 A WW LPART+KRSYH Y Sbjct: 569 AEWWYLPARTHKRSYHRY 586 >UniRef50_Q0SHW7 Cluster: Putative uncharacterized protein; n=1; Rhodococcus sp. RHA1|Rep: Putative uncharacterized protein - Rhodococcus sp. (strain RHA1) Length = 243 Score = 33.9 bits (74), Expect = 4.2 Identities = 17/32 (53%), Positives = 19/32 (59%), Gaps = 3/32 (9%) Frame = -2 Query: 502 TTAAPP---FNSKRITSSRRK*AGWWCLPART 416 TT PP + S R S+RR AGWWC ART Sbjct: 3 TTPCPPPRSWVSSRPASARRAAAGWWCRSART 34 >UniRef50_Q7NGA4 Cluster: Gll3269 protein; n=4; Bacteria|Rep: Gll3269 protein - Gloeobacter violaceus Length = 651 Score = 33.1 bits (72), Expect = 7.3 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = +1 Query: 328 KINKPNIVSSLDTYIQVYRYIYTGGRTSCKSARVGTTTLPISAV 459 KI V +T+ Q+ RYIYT G T+ +S +V T LP S++ Sbjct: 137 KIGSTQYVYIAETH-QINRYIYTNGDTTAQSRQVIVTNLPDSSL 179 >UniRef50_A7B1N8 Cluster: Putative uncharacterized protein; n=1; Ruminococcus gnavus ATCC 29149|Rep: Putative uncharacterized protein - Ruminococcus gnavus ATCC 29149 Length = 668 Score = 33.1 bits (72), Expect = 7.3 Identities = 20/58 (34%), Positives = 30/58 (51%) Frame = -3 Query: 453 GNRQGGGAYPRGLTRGPTTCIYISVYLYICIKG*YNIWFIYLCN*RLVLFGIANKSLM 280 GN G G YP+ + P C + ++ + YN++ I+LC LVLFG+ LM Sbjct: 39 GNFAGNGTYPQAASLHPLVCFHTALTDFP-----YNLYGIFLC---LVLFGLLTFLLM 88 >UniRef50_A5P3C2 Cluster: Putative uncharacterized protein; n=1; Methylobacterium sp. 4-46|Rep: Putative uncharacterized protein - Methylobacterium sp. 4-46 Length = 156 Score = 32.7 bits (71), Expect = 9.7 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Frame = -3 Query: 492 PHPSI----RNALPLHGGNRQGGGAYPRGLTRGP 403 PHP + R P HGGN G PRG RGP Sbjct: 11 PHPRVAPGERGRRPRHGGNVAAPGMLPRGSPRGP 44 >UniRef50_A0PYD2 Cluster: Helicase, SNF2/RAD54 family, putative; n=1; Clostridium novyi NT|Rep: Helicase, SNF2/RAD54 family, putative - Clostridium novyi (strain NT) Length = 1041 Score = 32.7 bits (71), Expect = 9.7 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = +3 Query: 114 YYTIYISRGERLFGLSDIFATTRESLKLKTWKKYHNKKYFF 236 ++ I + ER++ LS++ R + K+ T +K+H+K Y F Sbjct: 94 FHNINEEQEERIYDLSEMIKAGRVNFKIYTKEKFHSKAYIF 134 >UniRef50_Q55A22 Cluster: Putative uncharacterized protein; n=3; Eukaryota|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 1180 Score = 32.7 bits (71), Expect = 9.7 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +3 Query: 204 WKKYHNKKYFFRYLNGVT*LKFN*KPSNSCWQYQIKQAF 320 WK +HNK FF+ +N + LKF+ ++ + I++ F Sbjct: 35 WKVFHNKFLFFKIINSIEELKFDFPNISTYYDLNIRKKF 73 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 684,008,040 Number of Sequences: 1657284 Number of extensions: 13810212 Number of successful extensions: 31026 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 28982 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30511 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 60088620670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -