BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0333 (737 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19G12.09 |||NADH/NADPH dependent indole-3-acetaldehyde reduc... 27 3.7 SPAPJ696.01c |vps17||retromer complex subunit Vps17|Schizosaccha... 26 4.9 SPCC1827.04 |||ankyrin repeat protein, unknown biological role|S... 25 8.5 >SPAC19G12.09 |||NADH/NADPH dependent indole-3-acetaldehyde reductase AKR3C2|Schizosaccharomyces pombe|chr 1|||Manual Length = 284 Score = 26.6 bits (56), Expect = 3.7 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -3 Query: 162 RLNQIAFHPSIYK 124 R+NQI FHP +YK Sbjct: 162 RVNQIEFHPQVYK 174 >SPAPJ696.01c |vps17||retromer complex subunit Vps17|Schizosaccharomyces pombe|chr 1|||Manual Length = 549 Score = 26.2 bits (55), Expect = 4.9 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -3 Query: 486 PSIRNALPLHGGNRQGGGAYPRGLTRGP 403 P IRN P G +R G YPR L+ P Sbjct: 452 PHIRNIDPFGGLSRLGREEYPRRLSNPP 479 >SPCC1827.04 |||ankyrin repeat protein, unknown biological role|Schizosaccharomyces pombe|chr 3|||Manual Length = 600 Score = 25.4 bits (53), Expect = 8.5 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +1 Query: 298 NTK*NKPLITKINKPNIVSSLDTYIQVYRYIYTGGRTSCKSARV 429 N + N PL T N + + TYI VY+++++G K V Sbjct: 146 NQRTNSPL-TWFQLSNASAEVPTYIGVYKHMFSGNNHITKDLLV 188 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,903,282 Number of Sequences: 5004 Number of extensions: 59670 Number of successful extensions: 146 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 146 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 349251756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -