BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0333 (737 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_02_0243 - 13433276-13434154,13434192-13434593,13434730-13434750 32 0.55 >06_02_0243 - 13433276-13434154,13434192-13434593,13434730-13434750 Length = 433 Score = 31.9 bits (69), Expect = 0.55 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -3 Query: 456 GGNRQGGGAYPRGLTRGPTTCIYISVYLYIC 364 GGNR+GG +Y R + RG T + +S+ Y C Sbjct: 356 GGNRRGGYSYGR-VWRGTTILVIVSMLAYFC 385 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,935,592 Number of Sequences: 37544 Number of extensions: 382595 Number of successful extensions: 766 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 746 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 765 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1945321620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -