BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0332 (728 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7592| Best HMM Match : PI-PLC-Y (HMM E-Value=1.1e-33) 28 6.7 SB_6709| Best HMM Match : PCNA_C (HMM E-Value=9.8) 28 6.7 >SB_7592| Best HMM Match : PI-PLC-Y (HMM E-Value=1.1e-33) Length = 997 Score = 28.3 bits (60), Expect = 6.7 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 208 FECG*HVLFAGKSDVSLDTCSRMLNVASFNVHR*V-DVDFQRTN 80 F G HV+F G S SL T +M V + N H+ V DV + TN Sbjct: 952 FASGEHVMFVGLSTQSLCTSFKMA-VIAVNEHKLVFDVSCENTN 994 >SB_6709| Best HMM Match : PCNA_C (HMM E-Value=9.8) Length = 279 Score = 28.3 bits (60), Expect = 6.7 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -1 Query: 548 HKKYITLLKKEPARSTKSK-TADARVNERPARR*HRAPQNLQLCRYK 411 H KYIT++ EP S + A + + + R HR ++C +K Sbjct: 51 HSKYITIIADEPYFSRHYRPVATSNFHRKGTRPTHRTTLTFEVCPFK 97 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,723,619 Number of Sequences: 59808 Number of extensions: 423692 Number of successful extensions: 864 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 802 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 860 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -