BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0330 (705 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17995| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 >SB_17995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 653 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +2 Query: 557 SLVSVMSSSNGFLRIVATDGNGVFVGWISSWCRSSLQITLQDD 685 SL+ ++ N ++R++A G W++ WC L L+DD Sbjct: 246 SLLLLILGGNAYVRLLAVAGVNFAAQWMAVWC-MGLTAHLRDD 287 >SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1831 Score = 27.9 bits (59), Expect = 8.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 568 CHVFLKRFLKNCSHRRKW 621 C +F + FLK+C H KW Sbjct: 1474 CDIFHRAFLKSCPHGLKW 1491 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,128,254 Number of Sequences: 59808 Number of extensions: 361045 Number of successful extensions: 697 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 646 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 697 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -