BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0327 (733 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 28 0.079 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 23 3.0 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 28.3 bits (60), Expect = 0.079 Identities = 17/59 (28%), Positives = 27/59 (45%) Frame = +2 Query: 113 QSSFGCDSCAGRRGAHDRGDAHAEHRAGSAPTARPLACPLLASETASLTPITPPPSDIV 289 +SS +C+G G H + P + L P+L+S T + +P+T S IV Sbjct: 284 RSSSASTTCSGHTVRCFTGGPRKSHES-QCPMLQKLEKPVLSSSTTTTSPMTSTKSTIV 341 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 23.0 bits (47), Expect = 3.0 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +1 Query: 646 HMTGDIHAVTAANNLLAAQNGRAHL 720 H G +HA N+L ++NG+ L Sbjct: 172 HNAGIVHADVKPKNILMSKNGQPKL 196 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,814 Number of Sequences: 438 Number of extensions: 4230 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -