BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0325 (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 pro... 24 4.8 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 24 4.8 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 23 8.4 >AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 protein. Length = 755 Score = 23.8 bits (49), Expect = 4.8 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -3 Query: 591 YKEFLPRGARKVTTGITGLWQPSVHSDVLF 502 + E+LPRG R + WQP S F Sbjct: 97 FNEYLPRGYRTELSRFNLKWQPMPFSSKPF 126 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.8 bits (49), Expect = 4.8 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -3 Query: 591 YKEFLPRGARKVTTGITGLWQPSVHSDVLF 502 + E+LPRG R + WQP S F Sbjct: 97 FNEYLPRGYRTELSRFNLKWQPMPFSSKPF 126 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 23.0 bits (47), Expect = 8.4 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -1 Query: 194 EPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRSM 87 + R GSK S + S+ E RR+P RSM Sbjct: 106 DARPRFGSKAAAANSSATSSESEDERRTPPQDMRSM 141 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 693,530 Number of Sequences: 2352 Number of extensions: 13358 Number of successful extensions: 20 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -