BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0324 (659 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 29 0.59 SPAPJ696.02 |||actin cortical patch component Lsb4 |Schizosaccha... 28 1.4 SPAC1782.09c |clp1|flp1|Cdc14-related protein phosphatase Clp1/F... 27 2.4 SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 26 5.5 SPAPB21F2.02 |||Dopey family protein|Schizosaccharomyces pombe|c... 26 5.5 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 7.3 SPCP31B10.07 |eft202||translation elongation factor 2 |Schizosac... 25 9.7 SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation elon... 25 9.7 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 29.1 bits (62), Expect = 0.59 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 376 SGCGRCRVWSMFVRYVRFSE 435 +GCG+ VW +VR+V F E Sbjct: 108 NGCGKSYVWPSYVRFVDFDE 127 >SPAPJ696.02 |||actin cortical patch component Lsb4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 430 Score = 27.9 bits (59), Expect = 1.4 Identities = 23/90 (25%), Positives = 40/90 (44%) Frame = -2 Query: 637 SSELTVERRSYRIVPIAHETKPTRLTARKIRGRPENAGPDPVRT*DDFRECHIKYIQFLR 458 SS+++ E S + +KP+R TA K + + ++ GP+ R F + F + Sbjct: 335 SSDVSTESSSQFSSRSSEYSKPSRPTAPKPKFKQDSLGPNQARAMYSFAGEQPGDLSFQK 394 Query: 457 PHYIKILTR*NEHNARTSTRPGTGRIRFPS 368 I I+ R H+ + R G FP+ Sbjct: 395 GDIIDIVERSGSHDDWWTGRIGYREGIFPA 424 >SPAC1782.09c |clp1|flp1|Cdc14-related protein phosphatase Clp1/Flp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 537 Score = 27.1 bits (57), Expect = 2.4 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = -2 Query: 247 ADMGTNRRDISTYIPHLNFQGPQRVSGHRRKCGALRVPNHISL 119 A GT++ +IST +P P++VSGH A R+P+ S+ Sbjct: 371 ATNGTSQSNISTPLPEPTPGQPRKVSGHNPP-SARRLPSASSV 412 >SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 25.8 bits (54), Expect = 5.5 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -1 Query: 155 MRCSSRSEPYLPSI-GFHGTRTLRQKRKLFPDLSAASSGHFGLPRRT 18 MR + E Y+ + G H T Q LF D + H L RRT Sbjct: 1 MRPAKSVEGYIIIVTGVHPEATEEQVEDLFADFGPVKNLHLNLDRRT 47 >SPAPB21F2.02 |||Dopey family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1687 Score = 25.8 bits (54), Expect = 5.5 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +2 Query: 422 FVLAS*YFNIMRPQKLYIFNMTLAKIVLRSD 514 F + S ++ ++P L + +M++A IVLR+D Sbjct: 255 FPIQSTFYKDVKPFDLKLLHMSVASIVLRND 285 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 7.3 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 413 TNIDQTRHRPHPLPVQTRHAPV 348 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 >SPCP31B10.07 |eft202||translation elongation factor 2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 842 Score = 25.0 bits (52), Expect = 9.7 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 14 RVFDGVTQSGLKTPPRGPGRV 76 RVF G +SGLK +GP V Sbjct: 399 RVFSGTVRSGLKVRIQGPNYV 419 >SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation elongation factor 2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 842 Score = 25.0 bits (52), Expect = 9.7 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 14 RVFDGVTQSGLKTPPRGPGRV 76 RVF G +SGLK +GP V Sbjct: 399 RVFSGTVRSGLKVRIQGPNYV 419 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,817,392 Number of Sequences: 5004 Number of extensions: 60118 Number of successful extensions: 176 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 169 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 176 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -