BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0320 (735 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0099 + 16633928-16638213,16638299-16638386,16638823-166389... 30 2.2 06_03_0836 - 25249491-25249511,25249883-25250050,25250721-252509... 28 6.7 11_01_0489 + 3776563-3776692,3776995-3777073,3777532-3777840,377... 28 8.8 01_06_1087 - 34430521-34430899,34432336-34432806,34432926-344331... 28 8.8 >06_03_0099 + 16633928-16638213,16638299-16638386,16638823-16638950, 16640008-16640278 Length = 1590 Score = 29.9 bits (64), Expect = 2.2 Identities = 19/40 (47%), Positives = 23/40 (57%), Gaps = 4/40 (10%) Frame = -2 Query: 722 ASAPS-IFQGWLLRQVSRCTLLSGFRL---PWPPSCCHER 615 A+AP + G+LLR + LLS RL P PP CCH R Sbjct: 54 AAAPRFMLDGYLLRHSAHFLLLSA-RLRPPPPPPRCCHRR 92 >06_03_0836 - 25249491-25249511,25249883-25250050,25250721-25250920, 25251000-25251324,25251981-25252045,25252231-25252552, 25252650-25252730 Length = 393 Score = 28.3 bits (60), Expect = 6.7 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +3 Query: 468 TPAYSNDEAGDLMTCQVGQFW*AELALWDEPNVV 569 T Y+N+ ++ C +G+FW EL ++P+V+ Sbjct: 168 TETYTNNHQNAIIVCPLGKFWRVELQR-EQPDVL 200 >11_01_0489 + 3776563-3776692,3776995-3777073,3777532-3777840, 3778828-3778898,3778975-3779213,3779306-3779383, 3779734-3780156,3780416-3780661,3780886-3780978, 3781480-3781527 Length = 571 Score = 27.9 bits (59), Expect = 8.8 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 273 KSIVGTGYRGERLIEPSSSWFRPKFPSG 356 + + GTG + PSS+WF P+ SG Sbjct: 12 RCVFGTGPLPPASLSPSSAWFDPELSSG 39 >01_06_1087 - 34430521-34430899,34432336-34432806,34432926-34433112, 34433470-34433599,34433794-34434125,34434566-34435050, 34435185-34435752,34436579-34436640,34437569-34437636 Length = 893 Score = 27.9 bits (59), Expect = 8.8 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -3 Query: 454 KFENRLRSFRPQCL*SFALPDETVLKFYIDASYPEGNF-GRNQLLDGSISLSPLY 293 K E LRSF + LP K+ I A++ GN+ GRN GS L L+ Sbjct: 93 KQEETLRSFPDGQRNCYTLPTNRSKKYLIRATFTYGNYDGRNSSESGSPFLFGLH 147 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,105,255 Number of Sequences: 37544 Number of extensions: 477984 Number of successful extensions: 1003 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 986 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1003 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1933531792 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -