BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0320 (735 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 58 1e-08 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 47 1e-05 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 46 3e-05 SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 37 0.019 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.079 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.079 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.079 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.079 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.42 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 32 0.55 SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.97 SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_46486| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.7) 30 1.7 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 29 3.9 SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_34697| Best HMM Match : Ion_trans (HMM E-Value=7.9e-38) 29 5.2 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 57.6 bits (133), Expect = 1e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +3 Query: 624 TAGRWPWKSESAKECATTHLPKQPALK 704 TAGRWPWK ESAKEC TTHLPKQ ALK Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALK 27 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 57.6 bits (133), Expect = 1e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +3 Query: 624 TAGRWPWKSESAKECATTHLPKQPALK 704 TAGRWPWK ESAKEC TTHLPKQ ALK Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALK 27 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 57.6 bits (133), Expect = 1e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +3 Query: 624 TAGRWPWKSESAKECATTHLPKQPALK 704 TAGRWPWK ESAKEC TTHLPKQ ALK Sbjct: 80 TAGRWPWKLESAKECVTTHLPKQLALK 106 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 50.4 bits (115), Expect = 1e-06 Identities = 27/55 (49%), Positives = 31/55 (56%) Frame = +1 Query: 571 KAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRLTCRSNQP*KMDGAEAFCLY 735 + +RS D KGVG S QQDGGHGS NPL+ KMDGA+A LY Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPLKECVTTPLPKQLALKMDGAQASHLY 64 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 48.0 bits (109), Expect = 8e-06 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +1 Query: 571 KAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRLTCRSNQP*KMDGAEAFCLY 735 + +RS D KGVG S QQDGGHGS NP + KMDGA+A LY Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPAKECVTTHLPKQLALKMDGAQASHLY 64 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 47.2 bits (107), Expect = 1e-05 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = +1 Query: 571 KAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRL 678 + +RS D KGVG S QQDGGHGS NPLR QRL Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPLRKGQRL 45 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 46.0 bits (104), Expect = 3e-05 Identities = 30/64 (46%), Positives = 35/64 (54%) Frame = -3 Query: 631 PAVMSDQRLSWCPMSVF*AP*TTFGSSHSASSAYQNWPTWHVIRSPASSFE*AGVLTHLK 452 P V SD+R W P F GSS ASS YQN PT I P + + G+LT+LK Sbjct: 62 PFVGSDERRLWHPYRAF-------GSSRIASSGYQNGPTRTRIHCPGFNKQ-VGLLTNLK 113 Query: 451 FENR 440 FENR Sbjct: 114 FENR 117 >SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 624 TAGRWPWKSESAKECATTHLPKQPALK 704 TAGR + ESAKEC TTHLPKQ ALK Sbjct: 1 TAGRVAMEVESAKECVTTHLPKQLALK 27 >SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 33 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +2 Query: 584 NAHGTP*KALVAHDSRTVAMEVGIR 658 +AH TP K LVA DSRTVAMEVGIR Sbjct: 9 DAHQTPQKVLVALDSRTVAMEVGIR 33 >SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = -1 Query: 252 PPSGFPLTST*PGIVHHLSGPSICA 178 PP FPL S GIVHHLSGP+ CA Sbjct: 5 PPPEFPLASPYSGIVHHLSGPNRCA 29 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = +3 Query: 645 KSESAKECATTHLPKQPALK 704 K ESAKEC TTHLPKQ ALK Sbjct: 9 KLESAKECVTTHLPKQLALK 28 Score = 28.7 bits (61), Expect = 5.2 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +1 Query: 625 QQDGGHGSRNPLRSVQRLTCRSNQP*KMDGAEAFCLY 735 QQDGGHG + KMDGA+A LY Sbjct: 2 QQDGGHGKLESAKECVTTHLPKQLALKMDGAQASHLY 38 >SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = +3 Query: 645 KSESAKECATTHLPKQPALK 704 K ESAKEC TTHLPKQ ALK Sbjct: 2 KLESAKECVTTHLPKQLALK 21 >SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = +3 Query: 645 KSESAKECATTHLPKQPALK 704 K ESAKEC TTHLPKQ ALK Sbjct: 2 KLESAKECVTTHLPKQLALK 21 >SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = +3 Query: 645 KSESAKECATTHLPKQPALK 704 K ESAKEC TTHLPKQ ALK Sbjct: 2 KVESAKECVTTHLPKQLALK 21 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 651 ESAKECATTHLPKQPALK 704 ESAKEC TTHLPKQ ALK Sbjct: 4 ESAKECVTTHLPKQLALK 21 >SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 651 ESAKECATTHLPKQPALK 704 ESAKEC TTHLPKQ ALK Sbjct: 4 ESAKECVTTHLPKQLALK 21 >SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 651 ESAKECATTHLPKQPALK 704 ESAKEC TTHLPKQ ALK Sbjct: 4 ESAKECVTTHLPKQLALK 21 >SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 651 ESAKECATTHLPKQPALK 704 ESAKEC TTHLPKQ ALK Sbjct: 4 ESAKECVTTHLPKQLALK 21 >SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 651 ESAKECATTHLPKQPALK 704 ESAKEC TTHLPKQ ALK Sbjct: 4 ESAKECVTTHLPKQLALK 21 >SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 651 ESAKECATTHLPKQPALK 704 ESAKEC TTHLPKQ ALK Sbjct: 4 ESAKECVTTHLPKQLALK 21 >SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) Length = 93 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 651 ESAKECATTHLPKQPALK 704 ESAKEC TTHLPKQ ALK Sbjct: 4 ESAKECVTTHLPKQLALK 21 >SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 651 ESAKECATTHLPKQPALK 704 ESAKEC TTHLPKQ ALK Sbjct: 4 ESAKECVTTHLPKQLALK 21 >SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 651 ESAKECATTHLPKQPALK 704 ESAKEC TTHLPKQ ALK Sbjct: 4 ESAKECVTTHLPKQLALK 21 >SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 651 ESAKECATTHLPKQPALK 704 ESAKEC TTHLPKQ ALK Sbjct: 4 ESAKECVTTHLPKQLALK 21 >SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 651 ESAKECATTHLPKQPALK 704 ESAKEC TTHLPKQ ALK Sbjct: 10 ESAKECVTTHLPKQLALK 27 >SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 35.5 bits (78), Expect = 0.045 Identities = 17/26 (65%), Positives = 19/26 (73%) Frame = -3 Query: 253 SSIRVSPDFDLTRHSSPSFGSQHLCS 176 +S RVS F L RHSSPSFGSQ + S Sbjct: 39 ASTRVSSGFTLFRHSSPSFGSQQMRS 64 >SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 34.7 bits (76), Expect = 0.079 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 654 SAKECATTHLPKQPALK 704 SAKEC TTHLPKQ ALK Sbjct: 5 SAKECVTTHLPKQLALK 21 >SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 34.7 bits (76), Expect = 0.079 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 654 SAKECATTHLPKQPALK 704 SAKEC TTHLPKQ ALK Sbjct: 5 SAKECVTTHLPKQLALK 21 >SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 34.7 bits (76), Expect = 0.079 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 654 SAKECATTHLPKQPALK 704 SAKEC TTHLPKQ ALK Sbjct: 5 SAKECVTTHLPKQLALK 21 >SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 34.7 bits (76), Expect = 0.079 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 654 SAKECATTHLPKQPALK 704 SAKEC TTHLPKQ ALK Sbjct: 5 SAKECVTTHLPKQLALK 21 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 33.9 bits (74), Expect = 0.14 Identities = 30/73 (41%), Positives = 36/73 (49%) Frame = -3 Query: 733 IGKTLQRHPFFRAGCFGR*VVAHSLADSDFHGHRPAVMSDQRLSWCPMSVF*AP*TTFGS 554 IG TL+RHPF +G +VA + + F G SD+R W F GS Sbjct: 24 IGATLERHPF--SG-----LVASAEQPTPFVG------SDERRLWHLNRAF-------GS 63 Query: 553 SHSASSAYQNWPT 515 S ASSAYQ WPT Sbjct: 64 SRIASSAYQKWPT 76 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 33.9 bits (74), Expect = 0.14 Identities = 30/73 (41%), Positives = 36/73 (49%) Frame = -3 Query: 733 IGKTLQRHPFFRAGCFGR*VVAHSLADSDFHGHRPAVMSDQRLSWCPMSVF*AP*TTFGS 554 IG TL+RHPF +G +VA + + F G SD+R W F GS Sbjct: 22 IGATLERHPF--SG-----LVASAEQPTPFVG------SDERRLWHLNRAF-------GS 61 Query: 553 SHSASSAYQNWPT 515 S ASSAYQ WPT Sbjct: 62 SRIASSAYQKWPT 74 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 313 ISLSPLYPVPTIDLHVR 263 ISLSPLYP TIDLHVR Sbjct: 38 ISLSPLYPNLTIDLHVR 54 >SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 32.3 bits (70), Expect = 0.42 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -3 Query: 562 FGSSHSASSAYQNWPTWHV 506 FGSS ASSAYQ WPT ++ Sbjct: 21 FGSSRIASSAYQKWPTRNI 39 >SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 562 FGSSHSASSAYQNWPT 515 FGSS ASSAYQ WPT Sbjct: 58 FGSSRIASSAYQKWPT 73 >SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 562 FGSSHSASSAYQNWPT 515 FGSS ASSAYQ WPT Sbjct: 21 FGSSRIASSAYQKWPT 36 >SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 562 FGSSHSASSAYQNWPT 515 FGSS ASSAYQ WPT Sbjct: 21 FGSSRIASSAYQKWPT 36 >SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 562 FGSSHSASSAYQNWPT 515 FGSS ASSAYQ WPT Sbjct: 59 FGSSRIASSAYQKWPT 74 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 562 FGSSHSASSAYQNWPT 515 FGSS ASSAYQ WPT Sbjct: 21 FGSSRIASSAYQKWPT 36 >SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 562 FGSSHSASSAYQNWPT 515 FGSS ASSAYQ WPT Sbjct: 21 FGSSRIASSAYQKWPT 36 >SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 562 FGSSHSASSAYQNWPT 515 FGSS ASSAYQ WPT Sbjct: 21 FGSSRIASSAYQKWPT 36 >SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 562 FGSSHSASSAYQNWPT 515 FGSS ASSAYQ WPT Sbjct: 21 FGSSRIASSAYQKWPT 36 >SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 562 FGSSHSASSAYQNWPT 515 FGSS ASSAYQ WPT Sbjct: 21 FGSSRIASSAYQKWPT 36 >SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) Length = 125 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 562 FGSSHSASSAYQNWPT 515 FGSS ASSAYQ WPT Sbjct: 100 FGSSRIASSAYQKWPT 115 >SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 562 FGSSHSASSAYQNWPT 515 FGSS ASSAYQ WPT Sbjct: 21 FGSSRIASSAYQKWPT 36 >SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 562 FGSSHSASSAYQNWPT 515 FGSS ASSAYQ WPT Sbjct: 21 FGSSRIASSAYQKWPT 36 >SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 562 FGSSHSASSAYQNWPT 515 FGSS ASSAYQ WPT Sbjct: 21 FGSSRIASSAYQKWPT 36 >SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 562 FGSSHSASSAYQNWPT 515 FGSS ASSAYQ WPT Sbjct: 21 FGSSRIASSAYQKWPT 36 >SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 562 FGSSHSASSAYQNWPT 515 FGSS ASSAYQ WPT Sbjct: 21 FGSSRIASSAYQKWPT 36 >SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 562 FGSSHSASSAYQNWPT 515 FGSS ASSAYQ WPT Sbjct: 21 FGSSRIASSAYQKWPT 36 >SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 562 FGSSHSASSAYQNWPT 515 FGSS ASSAYQ WPT Sbjct: 21 FGSSRIASSAYQKWPT 36 >SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 562 FGSSHSASSAYQNWPT 515 FGSS ASSAYQ WPT Sbjct: 143 FGSSRIASSAYQKWPT 158 >SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 31.1 bits (67), Expect = 0.97 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -3 Query: 562 FGSSHSASSAYQNWPTWHVIRSPAS 488 FGSS ASSAYQN P I PAS Sbjct: 21 FGSSRIASSAYQNGPLGTRIHCPAS 45 >SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 562 FGSSHSASSAYQNWPT 515 +GSS ASSAYQ WPT Sbjct: 21 YGSSRIASSAYQKWPT 36 >SB_46486| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.7) Length = 703 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/60 (26%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = +3 Query: 171 RSEHKCWDPKD--GELCLVRSKSGETLMEDVAILTCKSIVGTGYRGERLIEPSSSWFRPK 344 +++ C D ++ GE +KS +T D ++ +C+S++ TG + L + S RP+ Sbjct: 303 QNDLSCSDSENEGGESFSTTAKSKDTKANDYSMTSCRSVLATGLNEQSLAKRKESIRRPE 362 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -3 Query: 676 VVAHSLADSDFHGHRPAVMSDQRLSWCPMSVF 581 + H + ++DF G R A+M+D +L C S+F Sbjct: 386 LTTHFMDEADFLGDRIAIMADGQLRCCGSSLF 417 >SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -3 Query: 562 FGSSHSASSAYQNWPT 515 FGSS ASSA Q WPT Sbjct: 78 FGSSRIASSALQKWPT 93 >SB_34697| Best HMM Match : Ion_trans (HMM E-Value=7.9e-38) Length = 1851 Score = 28.7 bits (61), Expect = 5.2 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = +3 Query: 234 GETLMED--VAILTCKSIVGTGYRGERLIEPS 323 G TLM D VA+L C+ V T G LI+PS Sbjct: 1389 GFTLMHDSNVALLACQICVHTNTSGSTLIQPS 1420 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,666,511 Number of Sequences: 59808 Number of extensions: 510473 Number of successful extensions: 1277 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 1102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1274 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1974037988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -