BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0320 (735 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 26 1.1 AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. 23 9.8 AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. 23 9.8 AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. 23 9.8 AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. 23 9.8 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 9.8 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 26.2 bits (55), Expect = 1.1 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 6/65 (9%) Frame = +2 Query: 71 RTLDVRSGRMKL-SSYVRD----FRTPEASRFQSVNEGAL*AQMLGPERW*TM-PGQVEV 232 RT V +G ++ SY +D + T E +SV G +LGP W TM G +++ Sbjct: 588 RTKRVPAGLQRIIHSYFQDRELVYETSEGPVVRSVTAGVPQGSILGPTLWNTMYDGVLDI 647 Query: 233 RGNPD 247 PD Sbjct: 648 ALPPD 652 >AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 9.8 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +1 Query: 607 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 696 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 9.8 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +1 Query: 607 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 696 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 9.8 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +1 Query: 607 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 696 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 9.8 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +1 Query: 607 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 696 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 9.8 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +3 Query: 174 SEHKCWDPKDGELCLVRSKSGETLMEDVAILTCKSIVGTG 293 S+ +C+ PK E C + G T L CK+ G Sbjct: 189 SQGRCFGPKPRECCHLFCAGGCTGPTQSDCLACKNFYDDG 228 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 784,628 Number of Sequences: 2352 Number of extensions: 16149 Number of successful extensions: 44 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75260343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -