BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0320 (735 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL034365-6|CAA22263.1| 347|Caenorhabditis elegans Hypothetical ... 29 2.6 Z81053-4|CAB02879.1| 418|Caenorhabditis elegans Hypothetical pr... 28 6.0 Z78063-7|CAB01506.1| 418|Caenorhabditis elegans Hypothetical pr... 28 6.0 >AL034365-6|CAA22263.1| 347|Caenorhabditis elegans Hypothetical protein Y69E1A.6 protein. Length = 347 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -1 Query: 576 RLKLRLVHPTAPVLLTKIGPLGTSSDLRLHRSSKPE 469 R R HP +TK+GP LRL + S PE Sbjct: 311 RRGFRAQHPIISTQMTKVGPPSADISLRLKKLSAPE 346 >Z81053-4|CAB02879.1| 418|Caenorhabditis elegans Hypothetical protein E02A10.1 protein. Length = 418 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +1 Query: 592 WDTMKGVGRS*QQDGGHGSRNPLRSVQRLTCRSNQP*KMDGA 717 W T+ V +S Q+ G +R P+R + R + P K++ A Sbjct: 9 WKTLTSVSKSGQKKGRRNTRQPVRPLNRFYRIGSSPMKIEFA 50 >Z78063-7|CAB01506.1| 418|Caenorhabditis elegans Hypothetical protein E02A10.1 protein. Length = 418 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +1 Query: 592 WDTMKGVGRS*QQDGGHGSRNPLRSVQRLTCRSNQP*KMDGA 717 W T+ V +S Q+ G +R P+R + R + P K++ A Sbjct: 9 WKTLTSVSKSGQKKGRRNTRQPVRPLNRFYRIGSSPMKIEFA 50 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,306,496 Number of Sequences: 27780 Number of extensions: 378890 Number of successful extensions: 675 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 675 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1724918872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -