BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0318 (644 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 4.4 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 4.4 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 7.7 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 21 7.7 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.2 bits (45), Expect = 4.4 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -1 Query: 590 NLIFILEDYIPRDHSFKHVFSLVCLMML*IFF 495 + + +L Y+P D K S+ L+ L +FF Sbjct: 259 SFLTVLTFYLPSDSGEKVTLSISILISLHVFF 290 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.2 bits (45), Expect = 4.4 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -1 Query: 590 NLIFILEDYIPRDHSFKHVFSLVCLMML*IFF 495 + + +L Y+P D K S+ L+ L +FF Sbjct: 259 SFLTVLTFYLPSDSGEKVTLSISILISLHVFF 290 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.4 bits (43), Expect = 7.7 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -1 Query: 590 NLIFILEDYIPRDHSFKHVFSLVCLMML*IFF 495 + + +L Y+P D K S+ L+ L +FF Sbjct: 255 SFLTVLVFYLPSDSGEKVSLSISILLSLTVFF 286 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.4 bits (43), Expect = 7.7 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -1 Query: 590 NLIFILEDYIPRDHSFKHVFSLVCLMML*IFF 495 + + +L Y+P D K S+ L+ L +FF Sbjct: 251 SFLSVLVFYLPSDSGEKVSLSISILLSLTVFF 282 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,449 Number of Sequences: 438 Number of extensions: 3640 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19438227 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -