BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0309 (517 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB17E12.14c |||6-phosphofructo-2-kinase |Schizosaccharomyces ... 27 2.2 SPAC19A8.02 |||transcriptional coactivator |Schizosaccharomyces ... 25 8.9 >SPAPB17E12.14c |||6-phosphofructo-2-kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 474 Score = 26.6 bits (56), Expect = 2.2 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +2 Query: 332 YFSISHLLLIFSRHFNDSRFINNAGCAVTLLHNTNDPSLI 451 Y SHLL S FN +F + C + NDP ++ Sbjct: 263 YSKESHLLQHGSHSFNGKQFETSFNCLTPSENTVNDPQVL 302 >SPAC19A8.02 |||transcriptional coactivator |Schizosaccharomyces pombe|chr 1|||Manual Length = 1213 Score = 24.6 bits (51), Expect = 8.9 Identities = 15/54 (27%), Positives = 25/54 (46%) Frame = +2 Query: 221 ATKKKRSYLLLYINKIIYFAVKIKF*NLSSFTKV*LKYFSISHLLLIFSRHFND 382 A K + L Y+ ++ F I F + S K ++ F ++ L +RH ND Sbjct: 177 ARKSYFTVALQYVVRVTSFRSSIDFIVIESICKFSIETFRLTDRLHESNRHIND 230 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,871,430 Number of Sequences: 5004 Number of extensions: 34609 Number of successful extensions: 72 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -