BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0309 (517 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0123 - 927691-929223,930050-930268 29 1.7 04_01_0452 - 5859262-5859465,5859618-5859661,5859753-5859954,586... 29 1.7 03_01_0221 + 1752500-1752868,1753301-1753436,1753850-1753989,175... 27 8.9 >07_01_0123 - 927691-929223,930050-930268 Length = 583 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = -2 Query: 474 KILRNKKDIRLGSLVLWRRVTAQPALLINLE 382 +I R ++ RLG + WRR+TA LL++++ Sbjct: 43 RIWRRRRQRRLGFFLQWRRLTATFCLLLSIQ 73 >04_01_0452 - 5859262-5859465,5859618-5859661,5859753-5859954, 5860905-5860949 Length = 164 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -2 Query: 510 IVCHENRLLRTVKILRNKKDIRLGSLVLWRRVTAQPALLIN 388 + C + +L +L+NKK RL +LVL R ++ IN Sbjct: 19 LTCGDENMLAMFNVLKNKKSARLENLVLARNSFSRTVYNIN 59 >03_01_0221 + 1752500-1752868,1753301-1753436,1753850-1753989, 1754083-1754206,1754960-1755363 Length = 390 Score = 27.1 bits (57), Expect = 8.9 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -1 Query: 460 QEGYQAWIIGIVEKGNRTARIIDKPRV 380 +E Y+ W I G T R++D PR+ Sbjct: 30 REEYRRWPIAAESGGGETGRVLDMPRL 56 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,957,791 Number of Sequences: 37544 Number of extensions: 181527 Number of successful extensions: 332 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 331 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 332 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -