BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0304 (798 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 23 4.3 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 4.3 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 4.3 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 4.3 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 22 5.7 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 22 5.7 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 22 5.7 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 5.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 5.7 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 22.6 bits (46), Expect = 4.3 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 774 FDGSSATTMVVTGNG 730 FDG+ T++VVT NG Sbjct: 83 FDGTYQTSVVVTHNG 97 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 4.3 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%) Frame = +1 Query: 148 VAIRMPPVIPINH-----YLGVLKTN 210 +A+ PPV+P NH YL V++ N Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 4.3 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%) Frame = +1 Query: 148 VAIRMPPVIPINH-----YLGVLKTN 210 +A+ PPV+P NH YL V++ N Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 4.3 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%) Frame = +1 Query: 148 VAIRMPPVIPINH-----YLGVLKTN 210 +A+ PPV+P NH YL V++ N Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 22.2 bits (45), Expect = 5.7 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = +1 Query: 493 YTLLERNYRGCWHQTCP 543 + L+++N GCW+ P Sbjct: 330 FNLIDQNAVGCWNSLLP 346 Score = 22.2 bits (45), Expect = 5.7 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -3 Query: 136 NSWIVARRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 14 N +VAR A F V IN+ + R+ L+ T+N Sbjct: 351 NQAVVARHDEAMIFPADVKINRGLXWIISDRMPVFLLXTLN 391 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 22.2 bits (45), Expect = 5.7 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 774 FDGSSATTMVVTGNG 730 FDG+ T +VVT NG Sbjct: 151 FDGTYQTNVVVTHNG 165 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 22.2 bits (45), Expect = 5.7 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 774 FDGSSATTMVVTGNG 730 FDG+ T +VVT NG Sbjct: 151 FDGTYQTNVVVTHNG 165 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 5.7 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -2 Query: 125 RRKTNISESICQRCFHQ 75 RR+ N++E++C F Q Sbjct: 966 RRRLNVNETVCSDYFSQ 982 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 681 SKEGSRRANYPLPARGGSDEK*RYG 607 +K S+ AN P PA GG + + G Sbjct: 1014 AKPQSQEANKPKPATGGKGTRPKRG 1038 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 225,369 Number of Sequences: 438 Number of extensions: 5469 Number of successful extensions: 20 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25246416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -