BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0301 (616 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MG... 52 2e-06 BC048251-1|AAH48251.1| 322|Homo sapiens ZDHHC12 protein protein. 31 2.4 AL441992-6|CAI15406.1| 210|Homo sapiens zinc finger, DHHC-type ... 31 2.4 EF623992-1|ABR25252.1| 354|Homo sapiens Uba6-specific E2 conjug... 29 9.9 BC015920-1|AAH15920.1| 297|Homo sapiens GNB3 protein protein. 29 9.9 >BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MGC:134704) protein. Length = 44 Score = 52.0 bits (119), Expect = 2e-06 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*K 580 K VAMNAW PQASYPCGNFS TSC K Sbjct: 11 KSDVAMNAWPPQASYPCGNFSDTSCLK 37 >BC048251-1|AAH48251.1| 322|Homo sapiens ZDHHC12 protein protein. Length = 322 Score = 31.5 bits (68), Expect = 2.4 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = -2 Query: 306 HALGRAAGGAKLPSTGLS*TPLRPKPA*PNPARICSLWSPESRE 175 H A G P++ + TP P P P PA +CS SPE R+ Sbjct: 51 HLQAFAQPGTHFPTSNCTPTP--PTPVLPGPASLCSPASPELRQ 92 >AL441992-6|CAI15406.1| 210|Homo sapiens zinc finger, DHHC-type containing 12 protein. Length = 210 Score = 31.5 bits (68), Expect = 2.4 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = -2 Query: 306 HALGRAAGGAKLPSTGLS*TPLRPKPA*PNPARICSLWSPESRE 175 H A G P++ + TP P P P PA +CS SPE R+ Sbjct: 51 HLQAFAQPGTHFPTSNCTPTP--PTPVLPGPASLCSPASPELRQ 92 >EF623992-1|ABR25252.1| 354|Homo sapiens Uba6-specific E2 conjugating enzyme 1 protein. Length = 354 Score = 29.5 bits (63), Expect = 9.9 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = -2 Query: 309 VHALGRAAGGAKLPSTGLS*TPLRPKPA*PNPARICSLWSP 187 V A AAGGA P +GL+ P P A + A + S W P Sbjct: 45 VWAAAAAAGGAGGPGSGLAPLPGLPPSAAAHGAALLSHWDP 85 >BC015920-1|AAH15920.1| 297|Homo sapiens GNB3 protein protein. Length = 297 Score = 29.5 bits (63), Expect = 9.9 Identities = 13/51 (25%), Positives = 27/51 (52%) Frame = -1 Query: 172 SKQCDFTSRVSHSKRETRRRSPFGSRRSMLSVCFLTRASRLRRSGYNXVRC 20 S CD ++++ + T R++ G + ++CF + + RL +GY+ C Sbjct: 201 SGACDASAKLWDVREGTCRQTFTGHESDINAICFFSLSGRLLFAGYDDFNC 251 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,090,862 Number of Sequences: 237096 Number of extensions: 1914692 Number of successful extensions: 4272 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4272 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6579110070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -