BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0301 (616 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g44730.1 68416.m04814 kinesin motor protein-related similar t... 28 5.7 At5g18000.1 68418.m02111 transcriptional factor B3 family protei... 27 7.5 At1g06460.1 68414.m00684 31.2 kDa small heat shock family protei... 27 7.5 At1g67970.1 68414.m07764 heat shock factor protein, putative (HS... 27 9.9 >At3g44730.1 68416.m04814 kinesin motor protein-related similar to 4 other kinesin-like proteins of A. thaliana: F02P16.12 (PID:g2191180), katA (D11371), katB (D21137), and katC (D21138); contains non-consensus AT-AC splice sites at intron 10 Length = 1087 Score = 27.9 bits (59), Expect = 5.7 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +3 Query: 309 PNVRNCGSSRTEQYYYRNDKPSVG*N*PVSRRSNPAHVP 425 P+ R+ + R RN KP V N PVSR PA VP Sbjct: 829 PSRRSLSTDRASTIKSRN-KPDVTQNLPVSRTPFPARVP 866 >At5g18000.1 68418.m02111 transcriptional factor B3 family protein contains Pfam profile PF02362: B3 DNA binding domain Length = 307 Score = 27.5 bits (58), Expect = 7.5 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = +2 Query: 467 RNDRKSRHRRIKKQVAMNAWLPQASYPC 550 R +RKS ++ +KK+ + +W ++S+PC Sbjct: 135 REERKSIYKDVKKEEEIESW-SESSHPC 161 >At1g06460.1 68414.m00684 31.2 kDa small heat shock family protein / hsp20 family protein contains Pfam profile: PF00011 Hsp20/alpha crystallin family Length = 285 Score = 27.5 bits (58), Expect = 7.5 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -2 Query: 240 RPKPA*PNPARICSLWSPESREALNNVTLLVAFRIQNAR-RDVEAHLD 100 RPK P A + ++WSP S A + + +VA + A D+ +D Sbjct: 169 RPKLDLPKLANLGTVWSPRSNVAESTHSYVVAIELPGASINDIRVEVD 216 >At1g67970.1 68414.m07764 heat shock factor protein, putative (HSF5) / heat shock transcription factor, putative (HSTF5) identical to heat shock transcription factor 5 (HSF5) SP:Q9S7U5 from [Arabidopsis thaliana]; contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 374 Score = 27.1 bits (57), Expect = 9.9 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = -1 Query: 289 GRWCEATIHGIILNASKAEASLAESGKDMLTVEPRESGGSKQCD 158 G W + + +K + ++ + GKD LT+E E G+ + D Sbjct: 286 GAWEKLLLLSPSRKKTKKQENIVKKGKDDLTLEEEEEDGTMELD 329 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,411,641 Number of Sequences: 28952 Number of extensions: 278275 Number of successful extensions: 696 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 696 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1236350304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -