BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0300 (491 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 23 1.3 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 21 5.4 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 21 5.4 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 23.4 bits (48), Expect = 1.3 Identities = 11/44 (25%), Positives = 20/44 (45%) Frame = +2 Query: 326 CPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLXPDHAG 457 C +P S+ + L+ + + + Q NSP + P H+G Sbjct: 30 CTTSPATASLESSLSAAAVAAAAVNYAQQHNSPSPTGSSPQHSG 73 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 5.4 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 46 GKTNLSHDGLNPAHVPF*WVNNPTLG 123 GK N +PA PF W ++ + G Sbjct: 404 GKENYQTMSRDPARTPFQWDDSVSAG 429 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 5.4 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 46 GKTNLSHDGLNPAHVPF*WVNNPTLG 123 GK N +PA PF W ++ + G Sbjct: 404 GKENYQTMSRDPARTPFQWDDSVSAG 429 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,349 Number of Sequences: 438 Number of extensions: 2939 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13544190 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -