BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0295 (501 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q16V67 Cluster: Putative uncharacterized protein; n=1; ... 32 6.3 UniRef50_A2DN19 Cluster: Putative uncharacterized protein; n=1; ... 32 6.3 >UniRef50_Q16V67 Cluster: Putative uncharacterized protein; n=1; Aedes aegypti|Rep: Putative uncharacterized protein - Aedes aegypti (Yellowfever mosquito) Length = 565 Score = 32.3 bits (70), Expect = 6.3 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +3 Query: 447 NTQLSLDDLAPPSVL 491 NTQLSLDDL PPSVL Sbjct: 508 NTQLSLDDLGPPSVL 522 >UniRef50_A2DN19 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 1012 Score = 32.3 bits (70), Expect = 6.3 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +3 Query: 351 VIKLN*NIHNFFFQPVVENVPTIADYAPPSVLNTQLSLDDLAPPSVLQ 494 +IKL N + F++PV + TI D P V++ L + + PP +Q Sbjct: 761 IIKLAINFPDGFYRPVARIITTICDSYPEFVVSFHLIILESVPPRFIQ 808 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 415,941,582 Number of Sequences: 1657284 Number of extensions: 6844238 Number of successful extensions: 14800 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14282 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14797 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 29691847201 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -