BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0295 (501 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 23 7.7 AY752907-1|AAV30081.1| 97|Anopheles gambiae peroxidase 13A pro... 23 7.7 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 22.6 bits (46), Expect = 7.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 266 KDLYPIAPGAPC 231 K L P+APGA C Sbjct: 194 KGLIPVAPGAKC 205 >AY752907-1|AAV30081.1| 97|Anopheles gambiae peroxidase 13A protein. Length = 97 Score = 22.6 bits (46), Expect = 7.7 Identities = 15/52 (28%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = +3 Query: 345 YYVIKLN*NIHNFFFQPVVENVPTIADYAPPSVLNTQLSLDD-LAPPSVLQT 497 YY + N F + V VP PP + N +S + L+ P++ QT Sbjct: 36 YYSGYSSANRAGMFAEVAVGAVPAFLTMLPPDMYNDSMSAEILLSSPAMQQT 87 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 443,098 Number of Sequences: 2352 Number of extensions: 7917 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44823054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -