SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVm0295
         (501 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ370045-1|ABD18606.1|  285|Anopheles gambiae putative TIL domai...    23   7.7  
AY752907-1|AAV30081.1|   97|Anopheles gambiae peroxidase 13A pro...    23   7.7  

>DQ370045-1|ABD18606.1|  285|Anopheles gambiae putative TIL domain
           protein protein.
          Length = 285

 Score = 22.6 bits (46), Expect = 7.7
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -2

Query: 266 KDLYPIAPGAPC 231
           K L P+APGA C
Sbjct: 194 KGLIPVAPGAKC 205


>AY752907-1|AAV30081.1|   97|Anopheles gambiae peroxidase 13A
           protein.
          Length = 97

 Score = 22.6 bits (46), Expect = 7.7
 Identities = 15/52 (28%), Positives = 23/52 (44%), Gaps = 1/52 (1%)
 Frame = +3

Query: 345 YYVIKLN*NIHNFFFQPVVENVPTIADYAPPSVLNTQLSLDD-LAPPSVLQT 497
           YY    + N    F +  V  VP      PP + N  +S +  L+ P++ QT
Sbjct: 36  YYSGYSSANRAGMFAEVAVGAVPAFLTMLPPDMYNDSMSAEILLSSPAMQQT 87


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 443,098
Number of Sequences: 2352
Number of extensions: 7917
Number of successful extensions: 14
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 44823054
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -