Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVm0295
         (501 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g69480.1 68414.m07983 EXS family protein / ERD1/XPR1/SYG1 fam...    27   7.1  

>At1g69480.1 68414.m07983 EXS family protein / ERD1/XPR1/SYG1 family
           protein similar to  PHO1 protein [Arabidopsis thaliana]
           GI:20069032; contains Pfam profiles PF03105: SPX domain,
           PF03124: EXS family
          Length = 777

 Score = 27.1 bits (57), Expect = 7.1
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%)
 Frame = -1

Query: 432 EHNRL*WGHFLQQAER-KNYEYFNLI*SHNNMSWFNKTKSKNLKRKNYL 289
           E  RL +  F Q+  R K Y + NL+     M  + K  S+N  R NY+
Sbjct: 274 EQLRLVFSEFYQKLRRLKEYSFMNLLAFSKIMKKYEKIASRNASR-NYM 321


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,947,332
Number of Sequences: 28952
Number of extensions: 151821
Number of successful extensions: 274
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 271
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 274
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 888318720
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)