BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0290 (720 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q00802 Cluster: Low molecular mass 30 kDa lipoprotein 1... 54 5e-06 UniRef50_Q0VJV2 Cluster: Like moricin; n=3; Manduca sexta|Rep: L... 46 0.001 UniRef50_Q6UV17 Cluster: Endonuclease and reverse transcriptase-... 40 0.062 UniRef50_P19616 Cluster: Microvitellogenin precursor; n=3; Mandu... 38 0.33 >UniRef50_Q00802 Cluster: Low molecular mass 30 kDa lipoprotein 19G1 precursor; n=3; Bombyx mori|Rep: Low molecular mass 30 kDa lipoprotein 19G1 precursor - Bombyx mori (Silk moth) Length = 256 Score = 53.6 bits (123), Expect = 5e-06 Identities = 21/26 (80%), Positives = 25/26 (96%) Frame = -3 Query: 709 GNRMAFGYSGRVVGSPEQYAWGIKAF 632 G+RMA+GY+GRV+GSPE YAWGIKAF Sbjct: 231 GHRMAWGYNGRVIGSPEHYAWGIKAF 256 >UniRef50_Q0VJV2 Cluster: Like moricin; n=3; Manduca sexta|Rep: Like moricin - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) Length = 248 Score = 46.0 bits (104), Expect = 0.001 Identities = 22/39 (56%), Positives = 25/39 (64%) Frame = +2 Query: 407 MVDGNHSPPGRPYARLPTRAIKKLITKFQNIIPLFKIQF 523 M DGNHSP GRPYA LPTRA KL + F +I + F Sbjct: 1 MGDGNHSPSGRPYASLPTRAKMKLTSLFIFVIVALSLLF 39 >UniRef50_Q6UV17 Cluster: Endonuclease and reverse transcriptase-like protein; n=25; Arthropoda|Rep: Endonuclease and reverse transcriptase-like protein - Bombyx mori (Silk moth) Length = 986 Score = 39.9 bits (89), Expect = 0.062 Identities = 16/20 (80%), Positives = 20/20 (100%) Frame = +1 Query: 358 INGRKRLGSAPGIADVHGRR 417 ++GR+RLGSAPGIA+VHGRR Sbjct: 967 LSGRQRLGSAPGIAEVHGRR 986 >UniRef50_P19616 Cluster: Microvitellogenin precursor; n=3; Manduca sexta|Rep: Microvitellogenin precursor - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) Length = 249 Score = 37.5 bits (83), Expect = 0.33 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = -3 Query: 718 DTWGNRMAFGYSGRVVGSPEQYAWGIKAF 632 D+ G+R +G++G V+G+PE + W + AF Sbjct: 221 DSMGDRQVWGHNGNVIGNPELFGWSVVAF 249 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 698,004,895 Number of Sequences: 1657284 Number of extensions: 12976281 Number of successful extensions: 32404 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 31232 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32402 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 58264468239 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -